Official Gazette Notification Text
Official TranscriptINVITATION OF TENDERS ON “PERCENTAGE-RATE BASIS” FOR PROPOSED CIVIL, INTERIOR RENOVATION & FURNISHING, ELECTRICAL, HVAC & ALLIED SERVICES WORKS FOR PFRDA REGIONAL OFFICE AT 16TH FLOOR, F-WING, MAKER TOWERS, CUFFE PARADE, MUMBAI - 400 005, MUMBAI (MAHARASHTRA) Tender Ref. No.: PFRDA/06/12/11/0002/2017-ADMIN Dated: 4th February 2026 Tender Issuing Authority: PENSION FUND REGULATORY AND DEVELOPMENT...
INVITATION OF TENDERS ON “PERCENTAGE-RATE BASIS” FOR PROPOSED CIVIL, INTERIOR RENOVATION & FURNISHING, ELECTRICAL, HVAC & ALLIED SERVICES WORKS FOR PFRDA REGIONAL OFFICE AT 16TH FLOOR, F-WING, MAKER TOWERS, CUFFE PARADE, MUMBAI - 400 005, MUMBAI (MAHARASHTRA) Tender Ref. No.: PFRDA/06/12/11/0002/2017-ADMIN
Dated: 4th February 2026
Tender Issuing Authority:
PENSION FUND REGULATORY AND DEVELOPMENT AUTHORITY (PFRDA) E-500, TOWER E, 5TH FLOOR WORLD TRADE CENTRE, NAUROJI NAGAR NEW DELHI – 110 029.INDEX SL. DESCRIPTION PAGE NO.
NO.
PART A I Notice of Inviting Tender 3 II Eligibility Criteria 7 PART B (Technical Bid) I Application Form 10 II Letter of Transmittal 21 III Letter of Undertaking 22 PART C I Financial Bid 24 PART D I Pre-Bid Query Format 27 II Information to The Bidders 27 III Instructions to The Bidders 30 PART E I Integrity Agreement 34 II Articles of Agreement 39 III EMD Format (Indicative) 43 IV Performance Security Format (Indicative) 45 PART F I General Condition of Contracts 48 II Special Conditions of Contracts 66 III Proforma of Various Tests 75 IV Technical Specification (Civil & Allied Services) 95 V Technical Specifications for Interior Materials 133 VI Declaration 171 VII Proposed interior plan of Mumbai regional office of PFRDA 172 VIII Bill of Quantities (BoQ) 173PART - A I. NOTICE INVITING TENDERS (NIT) TENDER FOR PROPOSED CIVIL, INTERIOR RENOVATION & FURNISHING, ELECTRICAL, HVAC & ALLIED SERVICES WORKS FOR PFRDA REGIONAL OFFICE AT 16TH FLOOR, F- WING, MAKER TOWERS, CUFFE PARADE, MUMBAI - 400 005, MUMBAI (MAHARASHTRA).
Pension Fund Regulatory and Development Authority (PFRDA) is a statutory body, which operates within the legal framework of PFRDA Act, 2013, with an objective to promote old age income security by establishing, developing, and regulating pension funds, to protect the interests of subscribers to schemes of pension funds and for matters connected therewith or incidental thereto.
PFRDA, New Delhi invites tenders on “percentage-rate basis” for captioned work from firms / contractors of repute satisfying the set eligibility criteria in two bid system for the following work.
Details of the tenders are as under:
Sr. No. Particulars Details 1 Name of work Tender for Proposed Composite Interior Works Consisting of Civil, Interior Furnishing Works, Electrical & Allied Works, HVAC Works, & Other Allied Services Works (FAS, PAS, ACS, Data Networking, CCTV), AV System, etc. at 16th Floor, F-Wing, Maker Towers, Cuffe Parade, Mumbai - 400 005, Mumbai (Maharashtra).
2 Nature of Work Civil, Interior Renovation & Furnishing, Electrical & Air Conditioning Works at the premises of ONGC Limited which PFRDA has taken on an initial license basis for a period of five years.
3 Estimated Cost put to tender Rs.7,95,17,387/- (Rupees Seven crore ninety five lakhs seventeen thousand three hundred and eighty seven only) 4 Time allowed for completion 2 months (60 days) 5 Tender processing fee Rs.20,000/- plus GST @ 18% to be transferred electronically to (Non-refundable) designated Bank Account of PFRDA as mentioned below:
Beneficiary Name – Pension Fund Regulatory and Development Authority Bank Name - Indian Overseas Bank Branch Name – F-75, Poorvi Marg, Vasant Vihar Branch, New Delhi- 110057 Account No – 159901000000855 IFS Code – IOBA0001599 6 Earnest Money Deposit The bidders are requested to submit the Earnest Money of Rs.17,00,000/- (Rupees Seventeen Lakhs only) to be transferred electronically to designated Bank Account of PFRDA as mentioned below or in the form of Account payee demand draft in favour of Pension Fund Regulatory and Development Authority, New Delhi.
Details of bank account is given below:
Beneficiary Name – Pension Fund Regulatory and Development Authority Bank Name - Indian Overseas Bank 3Branch Name – F-75, Poorvi Marg, Vasant Vihar Branch, New Delhi- 110057 Account No – 159901000000855 IFS Code – IOBA0001599 EMD can also be submitted in the form of Bank Guarantee as per the format indicated under Part-E of this tender.
7 Performance Security 5% of contract amount The successful bidder(s) shall be responsible to submit Performance Security @ 5% of the Contract Value which can be in any of the
following form: a) Performance Bank Guarantee (BG) which should be valid up to 180 days from the date of completion of the contract. The successful bidder shall extend the Performance Security depending on the extension of the Contract period.
(Or) b) Performance Security may also be submitted in the form of Fixed Deposit Receipt issued by a Scheduled Commercial bank lien marked in favour of PFRDA and should be valid up to 180 days from the date of completion of the contract from the successful Bidder. The successful bidder shall extend the fixed deposit depending on the extension of the Contract period.
(Or) c) Performance Security may also be transferred electronically to PFRDA designated Bank Account as mentioned above.
EMD will be returned on receipt of Performance Guarantee.
8 Security Deposit / Retentio5n% of gross value of each running account bill Money 9 Date of availability of tender documents on Service Provider’s website
(a) Technical Bid 04th February 2026 till 19th February 2026 Available on website @ https://pfrda.org.in
(b) Indicative Financial bid
(c) Last date and time for 09th February 2026 till 06:00 PM receipt of written queries for clarification from bidders for (Pre-bid Queries to be sent to email ID: pa.rangarajan@pfrda.org.in;
Pre-bid meeting. v.chaurasia@pfrda.org.in; Balaji.b@pfrda.org.in only as per the format mentioned at Part-D of this tender)
Note: The intended bidders, along with queries have to mail the details of authorized representative viz name, mobile no., e-mail id along with authorization letter from the bidder.
(d) Date of Pre-bid meeting At 11:00 AM on 11th February 2026 and address of Pre-bid meeting Address of Pre-bid meeting:
Pension Fund Regulatory and Development Authority, E-500, Tower E, 5th Floor, World Trade Centre, Nauroji Nagar, New Delhi – 110 029.
Max. two representatives per bidder will be allowed to participate).
4Response to pre-bid queries will be posted on PFRDA website by 13th February 2026.
Only written queries submitted by the bidders till stipulated date and time will be discussed and clarified in the meeting.
10 Address for Submission of The Chief General Manager Physical Form of Technical Pension Fund Regulatory and Development Authority (PFRDA) Bid, Financial bid Administration Department, E-500, Tower E, 5th Floor, World Trade Centre, Nauroji Nagar, New Delhi – 110 029.
Note: -
1. It is the sole responsibility of the bidder to ensure submission of EMD with tender document (Technical Bid & Financial bid) by stipulated date & time at the above address, failing which the bid is liable to be summarily rejected.
2. The application forms have to be submitted in a prescribed format in a Two-cover system viz. Technical Bid as per Part-B of this tender and Financial bid as per Part-C of this tender in a sealed cover along with other details etc. as laid down in the enclosed Annexures. Both the above sealed covers one named as Technical Bid and the other Financial bid should be placed in a Third cover duly sealed and must reach the above-mentioned address and super scribed with the legend “TENDER FOR THE PROPOSED COMPOSITE INTERIOR WORKS CONSISTING OF CIVIL, INTERIOR FURNISHING WORKS, ELECTRICAL & ALLIED WORKS, HVAC WORKS, & OTHER ALLIED SERVICES WORKS (FAS, PAS, ACS, DATA NETWORKING, CCTV), AV SYSTEM, ETC. FOR PFRDA REGIONAL OFFICE AT 16TH FLOOR, F- WING, MAKER TOWERS, CUFFE PARADE, MUMBAI - 400 005, MUMBAI (MAHARASHTRA)”.
3. Spiral-bound bid & EMD along with tender processing fee (as per the prescribed mode) shall be submitted in a sealed envelope super scribing the Name of the Project.
4. In case of electronic transfer of EMD, the bidder shall enclose the proof of such transfer indicating the transaction reference number.
5. For electronic transfer of tender processing fee, the bidder shall enclose the proof of such transfer indicating the transaction reference number.
11 Last date & time for 19th February 2026 by 03:00 PM submission of Physical Tender Technical Bid
Note: No bid in any form will be accepted after the said date & time. (Including Prequalification PFRDA shall not be liable for any postal delay and / or communication Documents & Financial bid failure.
12 Date, Time and Venue for 19th February 2026 at 03:30 PM
opening of Technical Bid Note: In case the tender opening date is declared as holiday, the tender will be opened in the next working day at the same time.
Venue for opening of Technical Bid:
Pension Fund Regulatory and Development Authority (PFRDA) E-500, Tower E, 5th Floor, World Trade Centre, Nauroji Nagar, New Delhi – 110 029.
513 Date and Time of opening of The date & time shall be intimated only to the technically qualified Financial bid bidders on their provided e-Mail IDs.
14 Defects Liability period One year from the date of virtual completion of work / Final handing over of the site, whichever is later.
15 Liquidated Damages 0./5 0% per week subject to max. 5% of contract amount for delay in Compensation completion of work.
16 Validity of offer 150 days from the date of opening of Financial bid 17 Value of Interim Certificate No advance on materials / plant / machinery or mobilization advance shall be paid under any circumstances for the works carried out by the successful bidder. However, for the purpose of interim certificate, an amount of Rs.75,00,000 or more raised under an invoice at an interval of minimum 7 (Seven) days shall be paid to the successful bidder upon timely and satisfactory certification of work.
18 Evaluation of Financial bids a) Evaluation of bids shall be carried out in accordance with the Least and Cost Selection (LCS) methodology.
Finalization b) The Financial Bids shall be opened only in respect of those bidders who are found to be technically eligible (i.e. meeting the prescribed eligibility criteria and complied with all terms, conditions, and documentation requirements of this Tender Document).
c) Among the Technically Qualified Bidders, the bidder quoting the lowest evaluated financial bid shall be designated as L1 and shall be eligible for award of the contract, subject to due verification and satisfactory compliance with all requirements of the Tender.
19 For any details, please contact The Chief General Manager the following official (s) – Pension Fund Regulatory and Development Authority (PFRDA) Administration Department, E-500, Tower E, 5th Floor, World Trade Centre, Nauroji Nagar, New Delhi – 110 029.
Contact No.: 011-40717900 e-Mail ID: pa.rangarajan@pfrda.org.in 20 Details of Project Architect M/s. Shetgiri & Associates (Architects, Engineers, Interior designers, P.M.C., Valuers)
Office Address: Block No. 1, 1st Floor, “Safalya”, S.K. Bole Road, Dadar (West), Mumbai – 400 028, Maharashtra.
Contact No.: 022 – 2422 3900 / 2422 4014/9821138367 e-Mail ID: shetgiri@shetgiriassociates.in
Note:
1. The make of materials should be chosen strictly from the preferred makes as given in the tender.
2. Any clarifications sought after opening of the tenders will not be entertained at any cost.
3. Bidder should visit the website till last date of submission for changes/ corrigendum, if any.
4. PFRDA reserves the right to cancel or postpone the tender at any stage without assigning any reason.
5. Claims for revision of the Quoted price by any bidder after the tender will not be entertained.
6. PFRDA reserves the right to revise any date and/or time specified in this tender by notifying the changes on its official website and/or through email communication to the bidder(s). While reasonable efforts will be made to inform the same through other means, bidders are advised to regularly check the PFRDA website for updates, in their own interest.
67. The intending bidder must read the tender terms and conditions carefully. The bidder should only submit the bid if it considers itself eligible and is in possession of all the documents required. No conditions other than mentioned in the tender will be considered, and if given they will have to be withdrawn before opening of the financial bid.
8. This information and instructions for bidders posted on website shall form part of bid document.
9. The bid document consisting of plans, specifications, Bill of quantities of various types of items to be executed and the set of terms & conditions of the contract to be complied with and other necessary
documents can be seen and downloaded from website https://pfrda.org.in/ free of cost.
10. The Technical Bid shall be opened first on due date and time as mentioned above. The time and date of opening of financial bid of bidders qualifying the technical bid shall be communicated to them at a later date.
11. PFRDA reserves the right to reject any prospective application without assigning any reason thereof and to restrict the list of qualified bidders to any number deemed suitable by it, if too many bids are received satisfying the minimum laid down criteria.
12. PFRDA reserves the rights to accept or reject any or all the tenders, either in whole or in part without assigning any reason for doing so and any claim / correspondence shall be entertained in this regard.
13. Tenders received without EMD shall be summarily rejected.
14. In case the date of opening of tenders is declared as a holiday, the tenders will be opened on the next working day at the same time.
15. The bid becomes ineligible if the bidder does not submit all the documents stipulated in the bid document (including GST Registration and as stipulated in the bid documents).
16. For any clarifications regarding layout, Technical specifications, System requirements etc. please contact M/s. Shetgiri & Associates, Mumbai, whose address is mentioned in the NIT.
17. Corrigenda, if any, is to be followed as published in the website https://pfrda.org.in only. So, the bidders should visit the website till last date of submission for changes / corrigendum.
18. Applicants are advised to submit the complete set of documents (Technical bid) in properly spiral bound form. The incomplete applications or applications received in loose sheets shall be summarily rejected. The PFRDA will not be responsible for late receipt of application due to postal delay or any other reasons.
II. ELIGIBILITY CRITERIA A. MINIMUM ELIGIBILITY CRITERIA
The bidders must fulfil each of the following minimum eligibility criteria without fail: - a) The bidder should be either a Proprietary Concern, or a Partnership Firm, or a Limited Liability Partnership or a Public Limited Company or a Private Limited Company registered under the Companies Act 2013.
b) The bidder should have an experience of minimum 07 years in relevant field i.e. Composite Interior Furnishing Works as on 31st January 2026. c) The bidder should have registered/empanelled/enlisted with Central/State Govt. bodies / Public sector Undertakings, PSBs / Nationalized Banks / MES / Railway / Regulatory Bodies.
d) The bidder should have registration with GST, PF, ESIC, PAN No. and Prof. Tax etc. (as applicable). e) The bidder should have satisfactorily completed the works mentioned below during the last 7 (seven) years ending on 31st January 2026:
a. Three similar works each costing not less than 40% of the estimated cost put to tender:
OR b. Two similar works each costing not less than 50% of the estimated cost put to tender:
OR c. One similar work costing not less than 80% of the estimated cost put to tender.
7Note:
1. “Similar Works”: - The definition of similar work shall mean completed Works which should include Civil, Interior Furnishing Works, Electrical & Allied Works, HVAC Works, & Other Allied Services Works (FAS, PAS, ACS, Data Networking, CCTV), AV System, etc. (all the components executed under single contract) executed for Commercial / Institutional buildings for Central Govt. Dept./State Govt. Dept./ Semi Govt. Dept. / PSU / Public sector Banks / Reputed Private Sector Organisations listed on Stock Exchange/ NSE/ BSE during last 7 years as on 31st January 2026. Please refer brief description of work contained in this document. The work order and the completion certificate shall clearly indicate works completed pertaining to the above-mentioned services and as such the break-up thereof, which has to satisfy the minimum works qualifying criteria.
2. Estimated Cost put to tender is the total estimated bid amount mentioned in the NIT. f) Average Annual Financial Turnover: The Average annual financial turn over for last 3 years shall be at least 40% of the estimated cost put to tender. The requisite Turnover shall be duly certified by a Chartered Accountant with Seal/signatures and registration number with Unique Document Identification Number (UDIN), in support of claim.
g) Profit/Loss: The Bidder should at least have earned profit in minimum one year in the available last three consecutive balance sheets ending 31st March 2025. (Standalone financial statement), duly audited and certified by the Chartered Accountant.
h) Net Worth of the company /firm as on 31st March 2025, should be at least 40% of the estimated cost put to tender. i) Solvency Certificate: Self-Certified copy of Bank Solvency Certificate issued from Nationalized or any Scheduled Commercial Bank should be one in number for at least 40% of the estimated cost of the project put to tender. The certificate should have been issued within 6 months from original last date of the submission of the tender as per Form-B of this tender document.
B. ADDITIONAL QUALIFYING CRITERIA: a) The bidder must have completed at least 11,000 Sq. feet carpet area of similar work within two months. If the bidder has completed more than 11,000 Sq. feet carpet area, the days will be calculated on pro rata basis. The bidder must submit relevant documents regarding this qualifying criterion.
b) The intending bidder must submit the audited ITR of the last two Financial Years i.e. 2024-25 and 2023-
24.
NOTE: -
1. The applications of the bidders not fulfilling the aforementioned criteria will not be considered for opening the financial bid.
2. Only works executed in India shall be considered for similar work.
3. Qualified similar works shall be physically inspected by the PFRDA Officials/ Project Architect to ascertain the completion, performance on Quality of works for finalizing the technical bids.
4. If private work is shown in support of eligibility criteria, certified copy of Tax deducted at source (TDS) Certificate Form 16A and 26A) shall be submitted along with the experience certificate and TDS amount shall tally with the actual amount of work done. Otherwise, the amount that tally with TDS shall only be considered for eligibility.
5. Should possess and furnish technical personnel with sufficient skill set in all the above work types and details of personnel with qualification and experience to be submitted.
6. Joint-venture / consortia of firms/companies and foreign bidders are not eligible to quote for the tender.
7. The bidders submitting experience certificate for the works done in joint venture (JV)/consortium with other firms/companies, their proportionate experience to the extent of its share in the JV/consortium or work done by them shall only be allowed on submitting the valid proof of their share/work done.
88. Confidential reports from previous employers will be sought by client.
9. Bidders have to fulfil all the minimum eligibility criteria, failing which their bids will be summarily rejected and no correspondence in this regard will be entertained by the PFRDA.
10.Applications containing false and /or inadequate information will be summarily rejected.
11. Duly completed application form along with enclosures /documentary proof as prescribed in the said application form signed on each page by the authorized signatory should be submitted in Two separate sealed cover subscribed “Technical Bid” and “Financial bid” and the same are collectively kept in a sealed envelope and must reach the above-mentioned address. Please subscribe /write on the top of the envelope:
“TENDER FOR THE PROPOSED COMPOSITE INTERIOR WORKS CONSISTING OF CIVIL, INTERIOR FURNISHING WORKS, ELECTRICAL & ALLIED WORKS, HVAC WORKS, & OTHER ALLIED SERVICES WORKS (FAS, PAS, ACS, DATA NETWORKING, CCTV), AV SYSTEM, ETC. FOR PFRDA REGIONAL OFFICE AT 16TH FLOOR, F-WING, MAKER TOWERS, CUFFE PARADE, MUMBAI - 400 005, MUMBAI (MAHARASHTRA)”.
12. The sealed Technical Document along with the Financial bid (Technical bid document in Envelope-1, Financial bid in Envelope-2 and both these envelopes put in Envelope -3) must be sent by SPEED POST/COURIER or dropped in the tender box available at:
THE CHIEF GENERAL MANAGER PENSION FUND REGULATORY AND DEVELOPMENT AUTHORITY (PFRDA) Administration Department, E-500, Tower E, 5th Floor, World Trade Centre, Nauroji Nagar, New Delhi – 110029.
9PART - B TECHNICAL BID I. APPLICATION FORM Proposed Composite Interior Works Consisting of Civil, Interior Furnishing Works, Electrical & Allied Works, HVAC Works, & Other Allied Services Works (FAS, PAS, ACS, Data Networking, CCTV), AV System, etc. for PFRDA Regional Office At 16th Floor, F-Wing, Maker Towers, Cuffe Parade, Mumbai - 400 005, Mumbai (Maharashtra).
(Please read the Application Documents carefully before filling-up) (Please strike-off which is not applicable) 1 Name of the Bidder 2a Full Postal Address of Bidder 2b Telephone & Mobile No.
2c Email ID 3 Main Activities of Bidder (Please use additional sheet, if required) 4 Year of establishment of Bidder (Enclose certified copies of relevant documents) 5 Constitution of Bidder Sole Proprietorship / LLP / Partnership/ Private Ltd.
(Enclose certified copies of relevant / Public Ltd. documents) 6 Name of the Proprietor / Partners / Directors of 1. the Organization / Firm.
2.
3.
7a Details of Authorized Signatory
(i)Name of Authorized Signatory
(ii) Phone No.
(iii) Mobile No.
(iv) Email-ID 7b Mode of Authorization of Authorized Resolution / Partnership Deed / Registered Power signatory of Attorney / Proprietor / any other (please (Enclose certified copies of relevant specify) documents) 108 Whether registered with the registrar of companies / Registrar of firms. If so, mention number and dates.
(Enclose certified copies of relevant documents) 9a PAN No. (Income tax) (Enclose certified copies of relevant documents) 9b GST No. (Enclose certified copies of relevant documents) 9c PF Registration No.
(Enclose certified copies of relevant documents) 9d ESIC Registration No. (Enclose certified copies of relevant documents as) 10 If Registered in the Panel of other Organizations such as CPWD, PWD, MES, Banks etc.
Mention Name of Organization, Registration No. & Date and Category (Enclose certified copies of relevant documents) 11a Banker’s Details: (Enclose certified copies of Cancelled Cheque)
(i) Banker’s Name
(ii) Full Postal Address of Branch
(iii) Telephone No.
(iv) Account No.
(v) Type of Account 11b Solvency Limit (Enclose certified copies of relevant documents) 12a Yearly turnover of the Firm during the last 03 F.Y. 2024-25: financial years F.Y. 2023-24: (Enclose copy of Affidavit / Certificate from Chartered Accountant mentioning turnover of F.Y. 2022-23:
last 03 financial years)
Average:
12b Profit & Loss Statement of the last 03 financial F.Y. 2024-25: years F.Y. 2023-24: (Enclose self- certified one page summarized balance sheet (audited) and one page of F.Y. 2022-23: summarized Profit & Loss Account for the last 03 years collectively) 1112c Net Worth as on 31st March of preceding As on 31st March 2025:
Financial Year i.e., 2024-25. (Enclose copy of Certificate from Chartered Accountant) 13 Whether last three years IT returns filed (Please Yes / No enclose certified copies of the IT Returns of 2022-23, 2023-24 and 2024-25) (Enclose certified copies of relevant documents Certificates) 14 Details of similar works executed & completed. Please fill up enclosed Annexure-I & enclose copies of Work Order & Work Completion (Enclose certified copies of Work Completion Certificates) Certificates) 15 Please attach certified copies of Performance Attach Performance Reports duly filled-in & signed Report of at least 3 works referred to in by the Competent Authority of the Client as per Annexure-I Annexure-II 16 Any other relevant information Fill and attach as Annexure-III 17 Name, Address, Email and Contact Nos. of at least 3 persons who are in position and competent to report about the quality and performance of your Firm. (These 3 persons should have been associated with any 3 completed similar works mentioned in Annexure-I).
18 Details (Name, Designation, PF No.) of near relatives working in PFRDA. (for definition of near relatives please refer Instructions, Terms and Conditions) (Note: - All Enclosures must be self-certified by Authorised Signatory)
1. I/We have read and understood all the contents of these Application Documents and are acceptable to us.
I/We also certify that my/our firm fulfils the ELIGIBILITY CRITERIA for this work.
2. I/We hereby confirm and certify that the information given above are correct and true and the Annexures / Enclosures etc. enclosed herewith are genuine.
3. I/We are authorized to sign and submit the bid document(s).
4. I/We understand and agree that if at any stage it is found/noticed by the PFRDA that any information
provided by us is untrue / incorrect, partly or fully and / or concealed in these Application Documents and / or also in case of receipt of any adverse/ unsatisfactory report from previous or present clients/ Bankers, the PFRDA on its own discretion may reject application at any stage and/or may take any other appropriate action.
5. I/We also understand and agree that partly / wrongly filled application and / or applications not on prescribed proforma and / or applications not accompanying relevant Documents / Enclosures / Annexures and Application Documents not signed by the Authorised Signatory and / or received after the due date and time are liable to be summarily rejected by the PFRDA at its own discretion.
6. I/We understand and agree that this is merely an application and does not entitle us to be necessarily selected by the PFRDA and/or invite us for participation in tender process and PFRDA reserves the right to reject all and/or any application without assigning any reason thereof. PFRDA also reserves the right to cancel this tender at any stage of the process including not awarding the work at all to any party, based on its requirement, without being liable for any cost incurred by anyone.
127. I/We understand that notwithstanding of any participation in this process, there shall be no inherent right to seek any award of work or any consequent obligation on the part of PFRDA to award any work to us.
(Signature of Authorised Signatory) (Seal of the Firm)
Name: ………………………………
Designation in Firm: …………………………
Place: ………………… Date ……………………… (Please ensure to enclose all annexures / enclosures / relevant documents etc with application documents before submitting) Annexure – ‘I’ COMPLETED WORKS DETAILS OF ELIGIBLE SIMILAR NATURE OF WORKS COMPLETED DURING THE LAST SEVEN YEARS ENDING 31ST DECEMBER 2025.
Important - (Please mention all Amounts without GST) S. No. Particulars Similar work - 1 Similar work - 2 1 Name of Work/Project 2 Site Address 3 Name of Client /Organization 4 Name Designation Contact No.
Email Id Address of Officer i/c of Client to whom reference can be made 5 A Estimated Cost as per Tender Rs. Crores Rs. Crores floated / issued 5 B Contract Cost Rs. Crores Rs. Crores 6 Completion Cost Rs. Crores Rs. Crores 7 Completion Cost of Composite Interior Works Consisting of Civil, Interior Furnishing Works, Electrical & Allied Works, HVAC Works, & Other Allied Services Works (FAS, PAS, ACS, Data Networking, CCTV), AV System, etc.
138 A Date of Start of Work as per Contract / Work Order 8 B Actual Date of Start of Work 9 A Scheduled date of Completion of work as per Contract 9 B Actual Date of Completion of Work 10 A Stipulated Period of Completion as per Contract (Months) 10 B Actual Time taken in Completion (in Months) 11 Number of Authorized Extension granted by Client 12 Reasons of Delay 13 Penalty / LD Amount 14 Details of Dispute / Litigation, if any Any other relevant information, if the applicant wants to furnish.
15
Note:
Additional Sheets on the same format may be used, if required, for providing details of other similar works.
14Annexure – ‘II’ PERFORMANCE REPORT Important - (Please mention all Amounts without GST) S. No. Particulars Details 1 Name of Work 2 Location 3 Estimated Cost Rs.
4 Tendered Cost Rs.
5 Actual Completion Cost Rs.
6 Date of Start 7 A Stipulated Date of Completion 7 B Actual Date of Completion 8 Any Liquidated Damages / Yes / No Rs.
Penalty / Levy decided, if Yes, Amount 9 Performance Report Outstanding / Very Good / Good / Average / Poor
(i) Quality of Work Outstanding / Very Good / Good / Average / Poor
(ii) Timely Execution Outstanding / Very Good / Good / Average / Poor
(iii) Integrity as regard to Working Outstanding / Very Good / Good / Average / Poor
(iv) Ease in settling Extra Items Outstanding / Very Good / Good / Average / Poor
(v) Resourcefulness Outstanding / Very Good / Good / Average / Poor
(vi) Technical Proficiency Outstanding / Very Good / Good / Average / Poor
(vii) Litigation Yes / No
(viii) General Behavior / Conduct Outstanding / Very Good / Good / Average / Poor 10 Additional Information / Re- marks Additional Sheets on the same format may be used, if required. (Signature of Authorized Signatory / Officer / Engineer In charge) (Seal of the Officer) (not below Ex. Engineer or Equivalent)
Designation: Date:
15Annexure – III OTHER RELEVANT INFORMATION Details of Technical Staff with Bidder A Name of Manager / Engineer / Qualification With Firm for how Total Experience Supervisor many years in Years 1 2 3 4 5 6 7 (Please Use additional sheets on same Format, if Required) FORM ‘A’ FINANCIAL INFORMATION
Financial Analysis: Details to be furnished duly supported by figures in balance sheet / profit & loss account for the last three years duly certified and audited by the Chartered Accountant, as submitted by the applicant to the Income Tax Department (Copies to be attached):
(Amounts - Rupees in Lakhs) Sr. No. Particulars Financial Year 2022-23 2023-24 2024-25 i Gross annual Turnover ii. Profit/Loss (standalone financial statement).
Name of Chartered Accountant along with seal & signature:
Name of the Proprietor / Partner:
Membership no. / CP. No.:
UDIN No.:
Date:
Place:
16FORM ‘B’ FORM OF BANKERS’ / SOLVENCY CERTIFICATE OF RECENT DATE I.E. NOT OLDER THAN 6 MONTHS FROM THE DATE OF ISSUANCE OF THE TENDER FROM A SCHEDULED COMMERCIAL BANK To, The Chief General Manager Pension Fund Regulatory and Development Authority (PFRDA) Administration Department, E-500, Tower E, 5th Floor, World Trade Centre, Nauroji Nagar, New Delhi – 110029.
No.: Date:
SOLVENCY CERTIFICATE This is to certify that, to the best of our knowledge and information, M/s / Shri………………………………………………..………., a customer of our bank, has been maintaining Savings Bank / Current Account bearing number………………………………with our ………………………………………………. …………. Branch, since ……………….. (Month and Year). We understand from the customer that the certificate is for the purpose of Tender with your organisation. We further certify that M/s / Shri / Smt. …………………………………...is solvent to the extent of INR ……………………… (Rupees…………………………...only).
This certificate issued by the Bank on the specific request of the customer and should be regarded as without any guarantee or liability, financial or otherwise, on the part of the Bank or its officials.
(Signature) For the Bank
Note:
In case of partnership firm, certificate to include names of all partners as recorded with the Bank.
17FORM ‘C’ To The Chief General Manager Pension Fund Regulatory and Development Authority (PFRDA) Administration Department, E-500, Tower E, 5th Floor, World Trade Centre, Nauroji Nagar, New Delhi – 110029.
Subject: Submission of bids for the work of Proposed Composite Interior Works Consisting of Civil, Interior Furnishing Works, Electrical & Allied Works, HVAC Works, & Other Allied Services Works (FAS, PAS, ACS, Data Networking, CCTV), AV System, etc. at 16th Floor, F-Wing, Maker Towers, Cuffe Parade, Mumbai - 400 005, Mumbai (Maharashtra).
Sir, Having examined details given in NIT and bid document for the above work, I/we hereby submit the relevant
information: “It is to certify that as per the audited balance sheet and profit & loss account during the financial year__________________, the Net-worth of M/s _____________________________ (Name & Registered address of the individual / firm / company), as on 31st March 2025 is Rs._______________ after considering all liabilities.” Name of Chartered Accountant along with seal & signature:
Name of the Proprietor / Partner:
Membership no. / CP. No.:
UDIN No.:
Date:
Place:
18FORM “D" PROFORMA OF AFFIDAVIT FOR EXECUTION OF SIMILAR WORKS I/We undertake and confirm that eligible similar works(s) has/have not been got executed through another contractor on back to back basis. Further that, if such a violation comes to the notice of PFRDA, then I/we shall be debarred for bidding in PFRDA work for a period of five years. Also, if such a violation comes to the notice of PFRDA before date of start of work, PFRDA shall be free to forfeit the entire amount of Earnest Money Deposit / Performance Security.
NOTE: Affidavit to be furnished on a ‘Non-Judicial’ stamp paper worth Rs.500/- Signature of Bidder(s) or an authorized Officer of the firm with stamp Signature of Notary with Seal 19FORM “E" PROFORMA OF AFFIDAVIT FOR NON - BLACK LISTING I/we undertake and confirm that our firm/partnership firm has not been blacklisted by any State/Central Departments/PSUs/Autonomous bodies during the last 7 years of its operations. Further that, if such information comes to the notice of the PFRDA then I/we shall be debarred for bidding in PFRDA work for a period of five years. Also, if such an information comes to the notice of PFRDA on any day before date of start of work, the PFRDA shall be free to cancel the agreement and to forfeit the entire amount of Earnest Money Deposit/Performance Security.
NOTE: Affidavit to be furnished on a ‘Non-Judicial’ stamp paper worth Rs.500/-.
Signature of Bidder(s) or an authorized Officer of the firm with stamp Signature of Notary with seal 20II. LETTER OF TRANSMITTAL INFORMATION REGARDING ELIGIBILITY
From: .................................................. .................................................. ..................................................
To:
The Chief General Manager Pension Fund Regulatory and Development Authority (PFRDA) Administration Department, E-500, Tower E, 5th Floor, World Trade Centre, Nauroji Nagar, New Delhi – 110029.
Subject: Submission of bids for the work of Proposed Composite Interior Works Consisting of Civil, Interior Furnishing Works, Electrical & Allied Works, HVAC Works, & Other Allied Services Works (FAS, PAS, ACS, Data Networking, CCTV), AV System, etc. at 16th Floor, F-Wing, Maker Towers, Cuffe Parade, Mumbai - 400 005, Mumbai (Maharashtra).
Sir, Having examined details given in the bid document for the above work, I/we hereby submit the relevant information.
1. I/We hereby certify that all the statements made and information supplied in the enclosed Forms A to E and accompanying statement are true and correct.
2. I / we have furnished all information and details necessary for eligibility and have no further pertinent information to supply.
3. I/ we submit the requisite certified Banker’s certificate and authorize the Chief General Manager (Administration Department) to approach the Bank issuing the Banker’s certificate to confirm the correctness thereof. I/We also authorize Chief General Manager (Administration Department) to approach individuals, employers, firms and corporation to verify our competence, work experience, and general reputation.
4. I/we submit the following certificates in support of our suitability, technical knowledge and capability for
having successfully completed the following eligible similar works:
Name of Work Certificate from
Certificate:
It is certified that the information given in the enclosed eligibility bid are correct. It is also certified that I/We shall be liable to be debarred, disqualified/ cancellation of enlistment in case any information furnished by me/us found to be incorrect.
Enclosures:
Date of submission: Seal & Signature of bidder(s) 21III. LETTER OF UNDERTAKING To The Chief General Manager Pension Fund Regulatory and Development Authority (PFRDA) Administration Department, E-500, Tower E, 5th Floor, World Trade Centre, Nauroji Nagar, New Delhi – 110029.
Dear Sir, Having examined the drawings, specification, design and Bill of Quantities relating to the works specified in the memorandum hereinafter set out and having visited and examined the site of the works specified in the said memorandum and having acquired the requisite information relating thereto as affecting the tender, I/We hereby offer to execute the works specified in the said memorandum at the rates quoted by us and in accordance in all respects with the specifications, design, drawings and instructions in writing referred to in conditions of tender, the Articles of Agreement, Special Conditions, Bill of Quantities and Conditions of Contract and with such materials as are provided for by, and in all other respects in accordance with such conditions so far as they may be applicable.
MEMORANDUM
(a) Description of work Tender for Proposed Composite Interior Works Consisting of Civil, Interior Furnishing Works, Electrical & Allied Works, HVAC Works, & Other Allied Services Works (FAS, PAS, ACS, Data Networking, CCTV), AV System, etc. at 16th Floor, F-Wing, Maker Towers, Cuffe Parade, Mumbai - 400 005, Mumbai (Maharashtra).
(b) Earnest Money Rs.17,00,000/- (Rupees Seventeen Lakhs only)
(c) Time allowed for 2 months (60 days). completion of the Works
1) Should this tender be accepted, I/we hereby agree to abide by and fulfill the terms and provisions of the said conditions of contract annexed hereto so far as may be applicable or in default thereof to forfeit and pay to PFRDA, the amount mentioned in the said contract.
2) I / We have deposited a sum of Rs.17,00,000/- (Rupees Seventeen Lakhs Only) as Earnest Money with PFRDA which amount is not to bear any interest. Should I / We fail to execute the Contract when called upon to do so, I / we do hereby agree that this sum shall be forfeited by me/us to PFRDA.
3) I/ We understand that as per terms of this tender, PFRDA may consider accepting our tender in part or whole or may entrust the various work proposed in phases. We, therefore, undertake that we shall not raise any claim/ compensation in the eventuality of PFRDA deciding to drop any of the work from the scope of work of this tender at any stage during the contract period. Further, we also undertake to execute the work entrusted to us in phases on our approved percentage and within stipulated time limit without any extra claim for price escalation as also provided for in the clause 22pertaining to the “Instructions to Bidders” of this tender. I/We also understand that PFRDA may engage any other contractor for any part of the work, if needed, in its assessment to achieve the work in time.
4) I/ We, hereby, undertake that, we will obtain necessary statutory approvals/ necessary permission from relevant Govt/ competent authority in consultation with Project Architect M/s. Shetgiri & Associates for carrying-out the captioned project works time-to-time on behalf of the PFRDA. For the purpose, PFRDA will reimburse the statutory charges/cost as actual, on production of tax receipts/ invoices in original by us.
5) I/ We, hereby, also undertake that, we will not raise any claim for any escalation in the prices of any of the material during the currency of contract/execution/completion period including authorized extended contract period, if any.
6) I/We fully acknowledge and understand that timely completion of awarded work in a satisfactory manner shall be the essence of the award of work.
7) Our Bankers are: i) ii) Name of the partner of the firm Authorised to sign Or (Name of person having Power of Attorney to sign the Contract. (Certified true copy of the Power of Attorney should be attached) Yours faithfully, Signature of Bidder.
Signature and addresses of Witnesses i) ii) 23PART - C I. FINANCIAL BID (On the letter head of bidder)
Date:
Tender Reference No: PFRDA/06/12/11/0002/2017-ADMIN The Chief General Manager, Administration Department Pension Fund Regulatory and Development Authority E-500, Tower E, 5th Floor, World Trade Centre, Nauroji Nagar, New Delhi-110029 Dear Sir,
Subject: Financial Bid - Tender for Proposed Composite Interior Works Consisting of Civil, Interior Furnishing Works, Electrical & Allied Works, HVAC Works, & Other Allied Services Works (FAS, PAS, ACS, Data Networking, CCTV), AV System, etc. for PFRDA Regional Office At 16th Floor, F-Wing, Maker Towers, Cuffe Parade, Mumbai - 400 005, Mumbai (Maharashtra)
1. We have examined the referred tender, the receipt of which is hereby duly acknowledged and subsequent pre-bid clarifications/modifications/revisions, if any, furnished by PFRDA. We meet the requirements and agree to provide the services as set out in the said tender.
2. We attach hereto our response to the tender, which constitutes our financial bid for being considered for selection as contractor for the said assignment.
3. We hereby declare and confirm the following: a) We agree to the unconditional acceptance of all the terms and conditions set out in the tender. b) We undertake, if our bid is accepted, to adhere to the stipulations put forward in the tender or such adjusted plan as may subsequently be mutually agreed between us and PFRDA or its appointed representatives.
c) We confirm that the information contained in this bid or any part thereof, including its exhibits, schedules, and other documents and instruments delivered or to be delivered to PFRDA is true, accurate, and complete. This bid includes all information necessary to ensure that the statements therein do not in whole or in part mislead PFRDA as to any material fact.
d) We confirm that I/we are entitled to act on behalf of our corporation / company / firm / organization and empowered to sign this document as well as such other documents, which may be required in this connection.
e) We shall observe the confidentiality of all the information passed on to us in the course of the tender process and shall not use the information for any other purpose than the current tender.
24f) We also understand that PFRDA is not bound to accept the offer either in part or in full.
If PFRDA rejects the offer in full or in part PFRDA may do so without assigning any reasons therefore.
FORMAT FOR FINANCIAL BID PFRDA/06/12/11/0002/2017-ADMIN, dated 4th Tender Ref. No.
February 2026 Proposed Composite Interior Works Consisting of Civil, Interior Furnishing Works, Electrical & Allied Name of Work Works, HVAC Works, & Other Allied Services Works (FAS, PAS, ACS, Data Networking, CCTV), AV System, etc.
Name of the Firm Percentage ‘Above’ or ‘Below’ or ‘At par’ the estimated cost put to tender Amount ‘Above’ BOQ ‘Above’ or or Total Cost Sr. Amount % in ‘Below’ or ‘At Name of component ‘Below’ (Exclusive No. (Exclusive Figures par’ or ‘At of GST) of GST) (Exclusive of par’ GST) 1 2 3 4 5 6 = (3*5) 7 = (3+6) 1 Proposed Composite Interior Works Consisting of Civil, Interior Furnishing Works, Electrical & Allied Works, HVAC Works, & Other Allied Services Works (FAS, PAS, ACS, Data Networking, CCTV), AV System, etc. for PFRDA Regional Office at 16th Floor, F-Wing, Maker Towers, Cuffe Parade, Mumbai - 400 005, M umbai (Maharashtra)
Note:
1. Only one of the options (‘Above’ or ‘Below’ or ‘At par’) is to be filled. More than one option shall be rejected.
2. Rate filled in any form shall be considered only in %age up to two decimal only.
3. Rate shall be filled in figures only.
4. Rate filled at any other place in the document shall not be considered.
5. Bidder to enclose the BoQ with this financial bid, duly signed on all the pages of BoQ.
6. A single percentage rate for the entire work is to be quoted.
257. Quote shall not include any conditions attached to it and any such conditional financial bid shall be rejected.
8. Illustration: • If the BOQ amount (exclusive of GST) is ₹1,00,00,000 and the bidder quotes “Below” at
5.00%, the amount Below shall be ₹5,00,000 and the Total Cost shall be ₹95,00,000 (exclusive of GST). • Similarly, if the bidder quotes “Above” at 5.00%, the amount Above shall be ₹5,00,000 and the Total Cost shall be ₹1,05,00,000 (exclusive of GST).
• If the bidder quotes “At par (0.00%)”, the Total Cost shall remain ₹1,00,00,000 (exclusive of GST).
Dated this ________ Day of ___________ Year ______________ (Name and Signature of Authorized Signatory) _________________ (In the capacity of)
Duly authorized to sign the bid for and behalf of: (Name and Address of the applicant) (Seal/Stamp of the applicant) 26PART - D I. Pre-Bid Query Format All the pre-bid queries to be submitted through email (pa.rangarajan@pfrda.org.in;
v.chaurasia@pfrda.org.in; Balaji.b@pfrda.org.in) only by the given due date for submission of queries.
In no other way, pre-bid queries will be entertained. Pre-bid queries to be submitted strictly in the format
given below: (To be provided strictly in MS Excel format) Bidder Name Sl. No Tender Tender Existing Query / Suggestion Page No Clause No. Clause II. INFORMATION TO THE BIDDERS
1.0 General:
1.1 Letter of transmittal and forms for deciding eligibility are given in the respective sections of this tender.
1.2 All information called for in the enclosed forms should be furnished against the relevant columns in the forms. If for any reason, information is furnished on a separate sheet, this fact should be mentioned against the relevant column. Even, if no information is to be provided in a column, a ‘nil’ or ‘no such case’ entry should be made in that column. If any particulars/query is not applicable in case of the bidder, it should be stated as ‘Not applicable’. The bidders are cautioned that not giving complete information called for in the application forms or not giving it in clear terms or making any change in the prescribed forms
(or) deliberately suppressing the information may result in the bid being summarily disqualified. Bids shall be submitted online only and those received in physical form, by telegram or telex and those received late will not be entertained.
1.3 The bid should be type written. The bidder should sign each page of application, forms and documents before submission.
1.4 Over writing should be avoided. Corrections if any should be made by neatly crossing out, initialing, dating and rewriting. Pages of the eligibility criteria document are numbered. Additional Sheets if any added by the Bidder should also be numbered by him. They should be submitted as a package with signed letter of transmittal.
1.5 References, information and certificate from the respective clients certifying suitability, technical knowledge or capability of the bidder should be signed by an officer not below the rank of Executive Engineer or equivalent.
1.6 The bidder may furnish any additional information, which he thinks is necessary to establish his capabilities to successfully complete envisaged work. He is, however advised not to furnish superfluous information.
27No information shall be entertained after submission of eligibility criteria document unless it is called for by the Employer.
2.0 Definitions:
2.1 In this document the following words and expression have their meaning here by assigned to them.
2.2 Employer: Means the Pension Fund Regulatory and Development Authority (PFRDA), Head Office, E-500, Tower E, 5th Floor World Trade Centre, Nauroji Nagar New Delhi – 110029.
2.3 Bidder: Means the individual, proprietary firm, firm in partnership, limited company (private or public) or corporation.
2.4 “Year” means “Financial year” unless stated otherwise.
3.0 Method of Application:
3.1 If the bidder is an individual, the application shall be signed by him above his/her full type written name and current address.
3.2 If the bidder is a proprietary firm, the application shall be signed by the proprietor above his/her full type written name and the full name of his firm with its current address.
3.3 If the bidder is a firm in partnership, the application shall be signed by all the partners of the firm above their full type written names and current addresses or alternatively by a partner holding power of attorney for the firm. In the latter case a certified copy of the power of attorney should accompany the application.
In both the cases a certified copy of the partnership deed and current address of all the partners of the firm should accompany the application.
3.4 If the bidder is a limited company or a corporation, the bid shall be signed by a duly authorized person holding power of attorney for signing the application and certified copy of such power of attorney shall also be furnished. The bidder should also furnish a copy of memorandum of articles of association duly attested by a Public Notary.
4.0 Final Decision-Making Authority:
The Employer reserves the right to accept or reject any bid and to annul the process and reject all bids at any time without assigning any reason or incurring any liability to the bidders.
5.0 Particulars – Provisional:
The particulars of the work given in relevant section are provisional. They are liable to change and must be considered only as advance information to assist the bidder.
6.0 Site Visit:
The bidder is advised to visit the site of work, at his own cost, and examine it and its surroundings to himself collect all information that he considers necessary for proper assessment of the prospective assignment.
Intending Bidders are advised to inspect and examine the site and its surroundings and satisfy themselves before submitting their bids, the form and nature of the site, the means of access to the site, the accommodation they may require and in general shall themselves obtain all necessary information as to risks, contingencies and other circumstances which may influence or affect their bid. A bidder shall be deemed to have full knowledge of the site whether he inspects it or not and no extra charge consequent on any misunderstanding or otherwise shall be allowed. The bidder shall be responsible for arranging and maintaining at his own cost all materials, tools & plants, water, electricity access, facilities for workers and all other Services required for executing the work unless otherwise specifically provided for in the contract documents. Submission of a bid by a bidder implies that he has read this notice and all other contract documents and has made himself aware of the scope and specifications of the work to be done and of 28conditions and rates at which stores, tools and plant, etc. will be issued to him by the Government and local conditions and other factors having a bearing on the execution of the work.
7.0 Letter of Transmittal:
The Bidder should submit the letter of transmittal attached with the document.
8.0 Opening of Financial bid:
After evaluation of the technical bid (eligibility criteria), the financial bid only of the technically qualified bidders shall be opened at the notified time, date and place in the presence of the qualified bidders or their representatives. The bid shall remain valid for 150 (One hundred and fifty) days from the date of opening of Financial bid.
Bids which are abnormally low priced are liable to be rejected and the award may be made to the next lowest bidder. In the unlikely event of the lowest bid being quoted same by more than one bidder, PFRDA reserves the right to award the bid to the bidder who has comparably high average annual financial turnover in the immediate past three years.
9.0 Award criteria:
9.1 The employer reserves the right, without being liable for any damages or obligation to inform the bidder to:
(a) Amend the scope and value of contract to the bidder.
(b) Reject any or all the applications without assigning any reason.
9.2 Any effort on the part of the bidder or his agent to exercise influence or to pressurize the employer would result in rejection of his bid. Canvassing of any kind is prohibited.
10. If it comes to the notice of the PFRDA that the Bidder has suppressed any information or furnished misleading or inaccurate information, or in case whether any litigation currently in progress at the time of submission of bids lead to the decree by the Court of Law against the Bidder, the PFRDA reserves the right to nullify the qualification and to disqualify the Bidder at any stage of the project. If such information becomes available to the PFRDA prior to issue of Letter of Intent, the Bidder will be disqualified and will not be considered for award of work, even though the Bidder is eligible for LOI. If such information comes to the knowledge of the PFRDA after the award of work, the PFRDA reserves the right to terminate the Contract unilaterally at the total cost and risk of the Bidder and such action would include forfeiture of all deposits, guarantees etc. furnished in any form, all damages as determined at the time of termination. The PFRDA will also reserve the right to recover any amount paid by invoking guarantee(s).
11. The Bidder shall be deemed to have waived rights if any that they may have or perceive to have as a result of their not being technically qualified and shall not hold PFRDA for any loss they may have suffered due to their not being technically qualified.
12. The Financial Bids shall be opened only in respect of those bidders who are found to be technically qualified.
13. If, at any stage, it is found that the Bidder having been selected on the basis of his submissions and support documents thereof in the technical bid but after Award of Contract or during execution, his commitments of resources / levels of performance falls short from what has been promised in the technical bid or is not able to meet the technical specifications or requirements as duly called for in the Technical bid documents & technical specifications / Financial bid document, PFRDA reserves the right to take the Remedial 29actions, as it deems fit at the Cost & Risk to the Bidder so selected including termination of the contract & necessary action as deem fit.
14. PFRDA reserves the right to annul the process of tender or to accept or to reject all or any of the tenders without thereby incurring any liability to any applicant or any obligation to inform any participant of the grounds for its action or assigning any reasons thereof.
15. The Bidder hereby agrees to abide by PFRDA decision on all matters pertaining to the eligibility criteria & further tender bid documents and undertakes not to resort to any actions either Legal or otherwise against PFRDA in this regard, including direct / indirect canvassing / influencing etc. Violation of this clause will lead to summary disqualification of the bidder without any reference to them.
16. It is mandatory for all the bidders participating in the bidding to quote their offers only in terms of specific percentage-rates (only up to two decimal places) above / below / at par of the grand total amount. In case, any bidder fails to quote its percentage-rate above / below / at par of the grand total amount of the schedule of works, such tender shall be treated as “Incomplete Tender” and shall be liable for rejection.
III. INSTRUCTIONS TO THE BIDDERS
1.0 Scope of work Tenders on “percentage-rate basis” are invited by PFRDA, New Delhi for Proposed Composite Interior Works Consisting of Civil, Interior Furnishing Works, Electrical & Allied Works, HVAC Works, & Other Allied Services Works (FAS, PAS, ACS, Data Networking, CCTV), AV System, etc.
1. Site and its location
The proposed work is to be carried out at: 16th Floor, F-Wing, Maker Towers, Cuffe Parade, Mumbai - 400 005, Mumbai (Maharashtra).
2.0 Tender documents
2.1 The work has to be carried out strictly according to the conditions stipulated in the tender consisting of the following documents and the most workmen like manner. ➢ Instructions to bidders ➢ General conditions of Contract ➢ Special conditions of Contract ➢ Additional Conditions for Electrical Installation ➢ Technical Specifications ➢ Drawings ➢ Financial bid
2.2 The above documents shall be taken as complementary and mutually explanatory of one another but in case of ambiguities or discrepancies, shall take precedence in the order given below: ➢ Financial bid ➢ Technical Specifications 30➢ Additional Conditions, if any, for specialized trades such as Electrical Installation ➢ General conditions of Contract ➢ Special conditions of Contract ➢ Instructions to bidders
2.3 Complete set of tender documents including relative drawings can be downloaded from the PFRDA website during the period mentioned in the NIT.
3.0 Site Visit
3.1 The bidder must obtain himself on his own responsibility and his own expenses all information and data which may be required for the purpose of filling this tender document and enter into a contract for the satisfactory performance of the work. The Bidder is requested satisfy himself regarding the availability of water, power, transport and communication facilities, the character quality and quantity of the materials, labour, the law & order situation, climatic conditions local authorities requirement, traffic regulations etc;
The bidder will be fully responsible for considering the financial effect of any or all the factors while submitting his tender.
4.0 Earnest Money Deposit
4.1 The bidders are requested to submit the Earnest Money of Rs.17,00,000/- (Rupees Seventeen Lakhs only) to be transferred electronically to designated Bank Account of PFRDA as mentioned below or in the form of Account payee demand draft in favour of Pension Fund Regulatory and Development Authority, New Delhi. Details of bank account is given below:
Beneficiary Name – Pension Fund Regulatory and Development Authority Bank Name - Indian Overseas Bank Branch Name – F-75, Poorvi Marg, Vasant Vihar Branch, New Delhi-110057 Account No – 159901000000855 IFS Code – IOBA0001599 EMD can also be submitted in the form of Bank Guarantee as per the format indicated under Part-E of this tender.
4.2 EMD in any other form other than as specified above will not be accepted. Tender not accompanied by the EMD in accordance with clause 4.1 above shall be rejected.
4.3 No interest will be paid on the EMD under any circumstances.
4.4 EMD of unsuccessful bidder will be refunded within 30 days of award of Contract.
4.5 EMD of successful bidder will also be returned on receipt of Performance Security.
4.6 The EMD may be forfeited: a) if a bidder withdraws his Bid during the period of Bid validity specified in this tender; or b) if a bidder makes any statement or encloses any form which turns out to be false/incorrect at any time prior to signing of Contract; or c) if the successful bidder fails to accept Purchase Order and/or sign the Contract with PFRDA or furnish Performance Security, within the specified period in the tender.
314.7 Micro and Small Enterprises (MSEs) as defined in MSE Procurement Policy issued by Department of Micro, Small and Medium Enterprises (MSMEs) or are registered with the Central Purchase Organization or the concerned Ministry or Department or Start-ups as recognized by Department of Industrial Policy & Promotion (DIPP) are exempted from submission of EMD.
5.0 Performance Security The successful bidder will have to submit a sum equivalent to 5% of accepted tender value in favour of PFRDA within a period of 15 days of acceptance of tender. EMD will be returned on receipt of Performance Security.
6.0 Security Deposit / Retention Money: Security Deposit / Retention Money shall be deducted from each running/final bill of the contractor at the rate of 5% of gross value of running account/final bill. The initial 50% of the total Security Deposit shall be paid to the contractor on the basis of Architect’s certifying the virtual completion. The balance 50% would be paid to the contractors after the defects liability period as specified in the contract.
6.2 No interest shall be paid to the amount retained by the PFRDA as Security Deposit.
7.0 Signing of contract Documents The successful bidder shall be bound to implement the contract by signing an agreement and conditions of contract attached herewith within 15 days from the receipt of intimation of acceptance of the tender by the PFRDA. However, the written acceptance of the tenders by the PFRDA will constitute a binding agreement between the PFRDA and successful bidder whether such formal agreement is subsequently entered into or not.
8.0 Completion Period:
The time period allowed for completion of the project shall be 2 months (60 days) from the date of commencement of work or 15 days from the date of issuance of work order, whichever is earlier.
9.0 Validity of tender Tenders shall remain valid and open for acceptance for a period of 150 days from the date of opening financial bid. If the bidder withdraws his/her offer during the value period or makes modifications in his/her original offer which are not acceptable to PFRDA without prejudice to any other right or remedy the PFRDA shall be at liberty to forfeit the EMD.
10.0 Liquidated Damages / Compensation The liquidated damages / compensation shall be 0.50% per week subject to a maximum of 5% of contract value.
11.0 Rate and Prices
11.1 In case of percentage tender,
11.1.1 The Bidders shall quote percentage above / below / at par (in figures as well as in words) on the total estimated cost given in Bill of Quantities, he will be willing to execute the work.
11.1.2 In percentage rate tenders only percentage quoted shall be considered. Any tender containing item rates is liable to be rejected. Percentage quoted by the bidder in percentage rate tender shall be accurately filled in figures, so that there is no discrepancy.
3211.1.3 The tender submitted shall be treated as invalid if the contractor does not quote percentage above / below / at par on the total amount of tender.
11.1.4 The rate and amount mentioned in the Bill of Quantities will be in Indian Currency (₹) only and will be firm and include all costs, allowances etc. except GST, which will be payable / reimbursed at actuals.
11.1.5 The PFRDA reserve their rights to accept any tenders, either in whole or in part or may entrust the work in phases or may drop the part scope of work at any stage of the project or get the works done through another contractor at the cost of the accepted bidder within its sole discretion without assigning any reason(s) for doing so and no claim / correspondence shall be entertained in this regard.
11.1.6 In case it is decided by the PFRDA to reduce the scope of work at any stage of the project, the contractor shall not be entitled to raise any claim / compensation on account of reduction in scope of work. Also, the PFRDA may consider for increase in scope of similar work in other buildings in phases but within a reasonable time interval and the contractor shall be bound to execute the same within the stipulated time period and as per rates quoted by them in this tender without any claim for price escalation.
12.0 Disputes, if any, arising out of this selection process, shall be subject to the exclusive jurisdiction of Courts at New Delhi only. Post the award of the Contract, the disputes, if any arising thereunder shall be settled in terms of the provisions of the Arbitration and Conciliation Act, 1996, as provided under such Contract.
33PART - E I. INTEGRITY AGREEMENT TO BE SIGNED BY THE BIDDER AND SAME SIGNATORY COMPETENT / AUTHORIZED TO SIGN THE RELEVANT CONTRACT WITH PENSION FUND REGULATORY AND DEVELOPMENT AUTHORITY.
INTEGRITY AGREEMENT This Integrity Agreement is made at .............................. on this ........................... day of ...........2026.
BETWEEN Pension Fund Regulatory and Development Authority represented through Chief General Manager (Administration Department), Head Office, E-500, Tower E,5th Floor, World Trade Centre, Nauroji Nagar, New Delhi- 110 029 (Hereinafter referred as the ‘Principal/Owner’, which expression shall unless repugnant to the meaning or context hereof include its successors and permitted assigns) AND .................................................................... (Name and Address of the Individual / firm/ Company) ………………. through .................................. (Hereinafter referred to as the (Details of duly authorized signatory) “Bidder/Contractor” and which expression shall unless repugnant to the meaning or context hereof include its successors and permitted assigns).
PREAMBLE:
WHEREAS the Principal / Owner has floated the Tender (NIT No. ...................................) (hereinafter referred to as “Tender/Bid”) and intends to award, under laid down organizational procedure, contract for “C/o ………………………………..”hereinafter referred to as the “Contract”.
AND WHEREAS the Principal/Owner values full compliance with all relevant laws of the land, rules, regulations, economic use of resources and of fairness/transparency in its relation with its Bidder(s) and Contractor(s).
AND WHEREAS to meet the purpose aforesaid both the parties have agreed to enter into this Integrity Agreement (hereinafter referred to as “Integrity Pact” or “Pact”), the terms and conditions of which shall also be read as integral part and parcel of the Tender/Bid documents and Contract between the parties.
NOW, THEREFORE, in consideration of mutual covenants contained in this Pact, the parties hereby agree as
follows and this Pact witness as under:
ARTICLE 1: Commitment of the Principal/Owner
1) The Principal/Owner commits itself to take all measures necessary to prevent corruption and to observe the
following principles:
(a) No employee of the Principal/Owner, personally or through any of his/her family members, will in connection with the Tender, or the execution of the Contract, demand, take a promise for or accept, for self or third person, any material or immaterial benefit which the person is not legally entitled to.
34(b) The Principal/Owner will, during the Tender process, treat all Bidder(s) with equity and reason. The Principal/Owner will, in particular, before and during the Tender process, provide to all Bidder(s) the same information and will not provide to any Bidders(s) confidential/additional information through which the Bidder(s) could obtain an advantage in relation to the Tender process or the Contract execution.
(c) The Principal/Owner shall endeavor to exclude from the Tender process any person, whose conduct in the past has been of biased nature.
2) If the Principal/Owner obtains information on the conduct of any of its employees which is a criminal offence under the Indian Penal code (IPC)/Prevention of Corruption Act, 1988 (PC Act) or is in violation of the principles herein mentioned or if there be a substantive suspicion in this regard, the Principal/Owner will inform the Chief Vigilance Officer of PFRDA and in addition may also initiate disciplinary actions as per its internal laid down policies and procedures.
ARTICLE 2: Commitment of the Bidder(s)/Contractor(s)
1) It is required that each Bidder/Contractor (including their respective officers, employees and agents) adhere to the highest ethical standards, and report to the PFRDA all suspected acts of fraud or corruption or Coercion or Collusion of which it has knowledge or becomes aware, during the tendering process and throughout the negotiation or award of a contract.
2) The Bidder(s)/Contractor(s) commits himself to take all measures necessary to prevent corruption. He commits himself to observe the following principles during his participation in the Tender process and during
the Contract execution: a) The Bidder(s)/Contractor(s) will not, directly or through any other person or firm, offer, promise or give to any of the Principal/Owner’s employees involved in the Tender process or execution of the Contract or to any third person any material or other benefit which he/she is not legally entitled to, in order to obtain in exchange any advantage of any kind whatsoever during the Tender process or during the execution of the Contract.
b) The Bidder(s)/Contractor(s) will not enter with other Bidder(s) into any undisclosed agreement or understanding, whether formal or informal. This applies in particular to prices, specifications, certifications, subsidiary contracts, submission or non-submission of bids or any other actions to restrict competitiveness or to cartelize in the bidding process.
c) The Bidder(s)/Contractor(s) will not commit any offence under relevant BNS 2023/PC Act. Further the Bidder(s)/Contract(s) will not use improperly, (for the purpose of competition or personal gain), or pass on to others, any information or documents provided by the Principal/Owner as part of the business relationship, regarding plans, technical bid and business details including information contained or transmitted electronically.
d) The Bidder(s)/Contractor(s) of foreign origin shall disclose the names and addresses of agents/representatives in India, if any. Similarly, Bidder(s)/Contractor(s) of Indian Nationality shall disclose names and address of foreign agents/representatives, if any. Either the India agent on behalf of the foreign principal or the foreign principal directly could bid in a tender but not both. Further, in cases where an agent participates in a tender on behalf of one manufacturer, he shall not be allowed to quote on behalf of another manufacturer along with the first manufacturer in a subsequent/parallel tender for the same item.
e) The Bidder(s)/Contractor(s) will, when presenting his bid, disclose (with each tender as per proforma enclosed) any and all payments he has made, is committed to or intends to make to agents, brokers or any other intermediaries in connection with the award of the Contract.
3) The Bidder(s)/Contractor(s) will not instigate third persons to commit offences outlined above or be an accessory to such offences.
4) The Bidder(s)/Contractor(s) will not, directly or through any other person or firm indulge in fraudulent practice means a willful misrepresentation or omission of facts or submission of fake/forged documents in 35order to induce public official to act in reliance thereof, with the purpose of obtaining unjust advantage by or causing damage to justified interest of others and/or to influence the procurement process to detriment of the Government interests.
5) The Bidder(s)/Contractor(s) will not, directly or through any other person or firm use Coercive Practices (means the act of obtaining something, compelling an action or influencing a decision through intimidation, threat or the use of force directly or indirectly, where potential or actual injury may befall upon a person, his/her reputation or property to influence their participation in the tendering process).
ARTICLE 3: Consequences of Breach Without prejudice to any rights that may be available to the Principal/Owner under law or the Contract or its established policies and laid down procedures, the Principal/Owner shall have the following rights in case of breach of this Integrity Pact by the Bidder(s)/Contractor(s) and the Bidder/Contractor accepts and undertakes to respect and uphold the Principal/Owner’s absolute right:
1) If the Bidder(s)/Contractor(s), either before award or during execution of Contract has committed a transgression through a violation of Article 2 above or in any other form, such as to put his reliability or credibility in question, the Principal/Owner after giving 14 days’ notice to the contractor shall have powers to disqualify the Bidder(s)/Contractor(s) from the Tender process or terminate/determine the Contract, if already executed or exclude the Bidder/Contractor from future contract award processes. The imposition and duration of the exclusion will be determined by the severity of transgression and determined by the Principal/Owner.
Such exclusion may be forever or for a limited period as decided by the Principal/Owner.
2) Forfeiture of EMD/Performance Security/Security Deposit: If the Principal/Owner has disqualified the Bidder(s) from the Tender process prior to the award of the Contract or terminated/determined the Contract or has accrued the right to terminate/determine the Contract according to Article 3(1), the Principal/Owner apart from exercising any legal rights that may have accrued to the Principal/Owner, may in its considered opinion forfeit the entire amount of Earnest Money Deposit, Performance Security and Security Deposit of the Bidder/Contractor.
3) Criminal Liability: If the Principal/Owner obtains knowledge of conduct of a Bidder or Contractor, or of an employee or a representative or an associate of a Bidder or Contractor which constitutes corruption within the meaning of BNS/Prevention of Corruption Act, or if the Principal/Owner has substantive suspicion in this regard, the Principal/Owner will inform the same to law enforcing agencies for further investigation.
ARTICLE 4: Previous Transgression
1) The Bidder declares that no previous transgressions occurred in the last 5 years with any other Company in any country confirming to the anticorruption approach or with Central Government or State Government or any other Central/State Public Sector Enterprises in India that could justify his exclusion from the Tender process.
2) If the Bidder makes incorrect statement on this subject, he can be disqualified from the Tender process or action can be taken for banning of business dealings/holiday listing of the Bidder/Contractor as deemed fit by the Principal/Owner.
3) If the Bidder/Contractor can prove that he has resorted/recouped the damage caused by him and has installed a suitable corruption prevention system, the Principal/Owner may, at its own discretion, revoke the exclusion prematurely.
36ARTICLE 5: Equal Treatment of all Bidders/Contractors/Subcontractors
1) The Bidder(s)/Contractor(s) undertake(s) to demand from all subcontractors a commitment in conformity with this Integrity Pact. The Bidder/Contractor shall be responsible for any violation(s) of the principles laid down in this agreement/Pact by any of its Sub-contractors/sub-vendors.
2) The Principal/Owner will enter into Pacts on identical terms as this one with all Bidders and Contractors.
3) The Principal/Owner will disqualify Bidders, who do not submit, the duly signed Pact between the Principal/Owner and the bidder, along with the Tender or violate its provisions at any stage of the Tender process, from the Tender process.
ARTICLE 6: Independent External Monitors (IEM)
1) The Principal/Owner has appointed IEM for this Pact as per Central Vigilance Commission order no 41/12/07 (Names and Addresses of the IEM to be given below).
NAME Mr Deepak Kashyap CADRE IRTS (Retired) E-mail ID deepakkashyapnd02@gmail.com NAME Shri Harishwar Dayal CADRE IDSE (Retd.) E-mail ID dayalagra@gmail.com
2) The task of the IEM shall be to review independently and objectively, whether and to what extent the parties comply with the obligations under this Pact.
3) The IEM shall not be subject to instructions by the representatives of the parties and perform their functions neutrally and independently.
4) Both the parties accept that the IEM have the right to access all the documents relating to the project/procurement, including minutes of meetings.
5) As soon as the IEM notices, or has reason to believe, a violation of this Pact, he will so inform the Authority designated by the Principal/Owner.
6) The BIDDER(s) accepts that the IEM has the right to access without restriction to all Project documentation of the Principal/Owner including that provided by the BIDDER. The BIDDER will also grant the IEM, upon his request and demonstration of a valid interest, unrestricted and unconditional access to his project documentation. The same is applicable to Subcontractors. The IEM shall be under contractual obligation to treat the information and documents of the BIDDER/ Subcontractor(s) with confidentiality.
7) The Principal/Owner will provide to the IEM sufficient information about all meetings among the parties related to the Project provided such meetings could have an impact on the contractual relations between the parties. The parties will offer to the IEM the option to participate in such meetings.
8) The IEM will submit a written report to the designated Authority of Principal/Owner /Secretary in the Department/ within 8 to 10 weeks from the date of reference or intimation to him by the Principal/ Owner / BIDDER and, should the occasion arise, submit proposals for correcting problematic situations.
ARTICLE 7: Facilitation of Investigation 37In case of any allegation of violation of any provisions of this Pact or payment of commission, the Principal/ Owner or its agencies shall be entitled to examine all the documents including the Books of Accounts of the BIDDER and the BIDDER shall provide necessary information and documents in English and shall extend all possible help for the purpose of such examination.
ARTICLE 8: Duration of the Pact This Pact begins when both the parties have legally signed it. It expires for the Contractor/Vendor, 60 months (5 years) after the completion of work under the contract or till the continuation of defect liability period, whichever is more and for all other bidders, till the Contract has been awarded. If any claim is made/lodged during the time, the same shall be binding and continue to be valid despite the lapse of this Pacts as specified above, unless it is discharged/determined by the Competent Authority, PFRDA.
ARTICLE 9: Other Provisions
1) This Pact is subject to Indian Law, place of performance and jurisdiction is Mumbai / location of the Principal/Owner, who has floated the Tender.
2) Changes and supplements need to be made in writing. Side agreements have not been made.
3) If the Contractor is a partnership or a consortium, this Pact must be signed by all the partners or by one or more partner holding power of attorney signed by all partners and consortium members. In case of a Company, the Pact must be signed by a representative duly authorized by board resolution.
4) Should one or several provisions of this Pact turn out to be invalid; the remainder of this Pact remains valid.
In this case, the parties will strive to come to an agreement to their original intensions.
5) It is agreed term and condition that any dispute or difference arising between the parties with regard to the terms of this Integrity Agreement/Pact, any action taken by the Owner/Principal in accordance with this Integrity Agreement / Pact or interpretation thereof shall not be subject to arbitration.
ARTICLE 10: LEGAL AND PRIOR RIGHTS All rights and remedies of the parties hereto shall be in addition to all the other legal rights and remedies belonging to such parties under the Contract and/or law and the same shall be deemed to be cumulative and not alternative to such legal rights and remedies aforesaid. For the sake of brevity, both the Parties agree that this Integrity Pact will have precedence over the Tender/Contract documents with regard any of the provisions covered under this Integrity Pact.
IN WITNESS WHEREOF the parties have signed and executed this Integrity Pact at the place and date first
above mentioned in the presence of following witnesses: ………………………..……………… …………………….……………………. (For and on behalf of Bidder/Contractor) (For and on behalf of Principal/Owner)
Date:
Place:
WITNESSES:
1. ……………………………………. (Signature, name and address)
2. …………………………………… 38(Signature, name and address) II. ARTICLES OF AGREEMENT (On non-judicial Stamp Paper of Rs. 1000/-) ARTICLES OF AGREEMENT made the ______________ date of _______ between Pension Fund Regulatory and Development Authority, having its Head office at New Delhi hereinafter called "the PFRDA" of the One Part and ________________________________________________________________ ______________________________________________________________________________________ __________________________________________________________
WHEREAS the PFRDA is desirous of ___________________________________________ ________________________________________________________________________ and has caused drawings and specifications describing the work to be done to be prepared by M/s. SHETGIRI & ASSOCIATES, its Architects.
AND WHEREAS the said Drawings numbered _______________ to_______________ inclusive, the Specifications and the Bill of Quantities have been signed by or on behalf of the parties hereto.
AND WHEREAS the Contractor has agreed to execute upon and subject to the Conditions set forth herein and to the Conditions set forth herein in the Special Conditions and in the Bill of Quantities and Conditions of Contract (all of which are collectively hereinafter referred to as “the said conditions”) the works shown upon the said Drawings and / or described in the said Specifications and included in the Bill of Quantities at the respective rates therein set forth amounting to the sum as therein arrived at our such other sum as shall become payable there under (hereinafter referred to as “the said Contract Amount.)
NOW IT IS HEREBY AGREED AS FOLLOWS:
1) In consideration of the said Contract Amount to be paid at the times and in the manner set forth in the said Conditions, the Contractor shall upon and subject to the said Conditions execute and complete the work shown upon the said Drawings and described in the said Specifications and the priced Bill of Quantities.
2) The Employer shall pay to the Contractor the said Contract Amount, or such other sum as shall become payable, at the times and in the manner specified in the said Conditions.
3) The term “the Architects” in the said Conditions shall mean the said M/s. SHETGIRI & ASSOCIATES, or in the event of their ceasing to be the Architects for the purpose of this Contract for whatever reason, such other person or persons as shall be nominated for that purpose by the Employer, not being a person to whom the Contractor shall object for reasons considered to be sufficient by the Employer, PROVIDED ALWAYS that no person or persons subsequently appointed to be Architects 39under this Contract shall be entitled to disregard or overrule any previous decisions or approval or direction given or expressed in writing by the outgoing Architects for the time being.
4) The said Conditions and Appendix thereto shall be read and construed as forming part of this Agreement, and the parties hereto shall respectively abide by submit themselves to the said Conditions and perform the Agreements on their part respectively in the said Conditions contained.
5) The term Electrical Consultant refers to ___________, Mumbai of their ceasing to be the Consultants for this Project, such other person or persons as may be appointed by the Architects with the approval of the Employer.
6) The Plans, Agreements and Documents mentioned herein shall form the basis of this Contract.
7) This Contract is neither a fixed lump-sum contract nor a piece work contract but a contract to carry out the work in respect of the entire building complex to be paid for according to actual measured quantities at the rates contained in the Bill of Quantities and Rates or as provided in the said Conditions.
8) The Contractor shall be responsible for taking the approvals / NOC’s from the statutory bodies like MCGM, Building Proposal, Ward Office of MCGM, Fire Departments, Ward Offices or any other Statutory approval authority and the official charges of these departments shall be reimbursed by the PFRDA on production of necessary documentary evidence in the form of challans & receipts. The successful contractor will indemnify the PFRDA / Architect for any problems arising out of such approvals. All the expenses involved for getting such approvals / NOC’s shall be paid by the contractor and no extra claim whatsoever shall be entertained. The Architect shall assist the contractor in coordination and making available the necessary drawings proposed by him for submission to the authorities, however the necessary follow-up & liasoning with these departments shall be the responsibility of the contractor. Any damage arising out of strict action of any of these departments shall be the sole liability of the contractor.
9) The Contractor shall afford every reasonable facility for the carrying out of all works relating to civil works, installation of lifts, Telephone, electrical installations, fittings air-conditioning and other ancillary works in the manner laid down in the said Conditions, and shall make good any damages done to walls, floors, etc. after the completion of his work.
10) The Employer reserves to itself the right of altering the drawings and nature of the work by adding to or omitting any items of work or having portions of the same carried out without prejudice to this Contract.
11) Time shall be considered as the essence of this Contract and the Contractor hereby agrees to commence the work soon after the Site is handed over to him or from 14th day after the date of issue of formal work
order as provided for in the said Conditions whichever is later and to complete the entire work within 24 month including monsoon and public holidays subject to nevertheless the provisions for extension of time.
12) All payments by the Employer under this Contract will be made only at New Delhi.
4013) All disputes arising out of or in any way connected with this Agreement shall be deemed to have arisen at Mumbai and only the Courts in Mumbai shall have jurisdiction to determine the same.
14) That the several parts of this Contract have been read by the Contractor and fully understood by the Contractor.
IN WITNESS WHEREOF THE EMPLOYER and the Contractor have set their respective hands to these presents and two duplicates hereof the day and year first hereinabove written.
SIGNATURE CLAUSE SIGNED AND DELIVERED by the _______________________ By the
(Employer) hand of Shri ___________________ ______________________________ (Signature of Employer) (Name and Designation)
In the presence of :
1) Shri / Smt. ___________________ (Signature of Witness) Address ___________________ ___________________
(Witness) SIGNED AND DELIVERED by the _______________________ by the
(Contractor) (Signature of Contractors)
in the presence of :
Shri / Smt. ___________________ (Signature of Witness) Address ___________________ ___________________
(Witness) APPENDIX HEREIN BEFORE REFERRED TO
411) Name of the Client Offering Contract : The Chief General Manager, Administration Department, Pension Fund Regulatory and Development Authority Head Office, E-500, Tower E, 5th Floor, World Trade Centre, Nauroji Nagar, New Delhi-110029.
2) Consultants : M/s SHETGIRI & ASSOCIATES Architects & Interior Designers, 1st Floor, Block No. 1, Safalya Building, S.K. Bole, Dadar (W) Mumbai-400028.
3) Site Address : 16th Floor, F-Wing, Maker Towers, Cuffe Parade, Mumbai - 400 005, Mumbai (Maharashtra).
4) Scope of Work : Proposed Civil, Interior Renovation & Furnishing, Electrical, HVAC & Allied Services Works
5) Name of the Contractor : ----------------------------------- ----------------------------------- ------------------------------------
6) Address of the Contractor : ------------------------------------ ------------------------------------ ------------------------------------
7) Period of Completion : 2 months from the work order. (60 days)
8) Earnest Money Deposit : Rs.17,00,000/- (Rupees Seventeen Lakhs only) 5 9 9
9) Security Deposit / Retention Money : As per the relevant clause of general Conditions.
10) Defects Liability Period : Twelve Months from the date of Virtual Completion.
11) Insurance to be undertaken by the : 125% of Contract Value Contractor at his cost (Contractor’s all-risk policy) Workmen Compensation Policy
12) Liquidated damages : 0.5% of the estimated amount shown in the tender per week max. 5% of the contract value.
13) Value of Interim Bill (Min.) : Rs. 75.00 lakhs.
4214) Period of Final Measurement : 2 (Two) Months from the date of Virtual Completion.
15) Performance Security : 5% of the contract amount. (pertaining to the relevant clause).
16) Refund of EMD : On receipt of Performance Security
17) Period for Honoring Certificate : 1. 10 working days for R.A. Bills
2. The final bill will be submitted by the Contractor within one month of the date and the Bill shall be Certified within two months from the date of receipt of final bill provided the bills are submitted with all pre-requisite documents/test reports etc prescribed in the tender.
________________________ Signature of Bidder.
Date:
III. EMD Format (Indicative) To Chief General Manager PENSION FUND REGULATORY AND DEVELOPMENT AUTHORITY (PFRDA) E-500, TOWER E, 5TH FLOOR WORLD TRADE CENTRE, NAUROJI NAGAR NEW DELHI – 110 029.
EMD for TENDER FOR PROPOSED CIVIL, INTERIOR RENOVATION & FURNISHING, ELECTRICAL, HVAC & ALLIED SERVICES WORKS FOR PFRDA REGIONAL OFFICE AT 16TH FLOOR, F-WING, MAKER TOWERS, CUFFE PARADE, MUMBAI - 400 005, MUMBAI
(MAHARASHTRA) - Tender Ref. No.- PFRDA/06/12/11/0002/2017-ADMIN, Dated 4th February 2026
WHEREAS Pension Fund Regulatory and Development Authority (PFRDA), having its Office at E-500, TOWER E, 5TH FLOOR, WORLD TRADE CENTRE, NAUROJI NAGAR, NEW DELHI – 110 029 has invited TENDER FOR PROPOSED CIVIL, INTERIOR RENOVATION & FURNISHING, ELECTRICAL, HVAC & ALLIED SERVICES WORKS FOR PFRDA REGIONAL OFFICE AT 16TH 43FLOOR, F-WING, MAKER TOWERS, CUFFE PARADE, MUMBAI - 400 005, MUMBAI
(MAHARASHTRA) - Tender Ref. No.- PFRDA/06/12/11/0002/2017-ADMIN, Dated 4th February 2026 It is one of the terms of said tender that bidder shall furnish a security for a sum of Rs 17,00,000 (Rupees Seventeen Lakhs only) as Earnest Money Deposit.
I. M/s._________, (hereinafter called as Bidder, who are our constituents intends to submit their Bid for the said work and have requested us to furnish guarantee in respect of the said of Rs 17,00,000 (Rupees Seventeen Lakhs only).
II. Now this Guarantee witnesseth that We __________ (Bank) do hereby agree and undertake that in the event of PFRDA coming to the conclusion that bidder i.e. _____(Name of the entity)_____ has not performed their obligations under the said conditions of the tender or has committed a breach thereof, which conclusion shall be binding on us as well as the said Bidder, we shall on demand by PFRDA, pay to PFRDA, without demur or protest to PFRDA, a sum of Rs 17,00,000 (Rupees Seventeen Lakhs only). Our guarantee shall be treated as equivalent to the Earnest Money Deposit for the due performance of the obligations of bidder under the said conditions, provided, however, that our liability against such sum shall not exceed the sum of Rs 17,00,000 (Rupees Seventeen Lakhs only) III. We also undertake and confirm that the sum not exceeding Rs 17,00,000 (Rupees Seventeen Lakhs only) as aforesaid shall be paid by us without any demur or protest, merely on demand from PFRDA on receipt of a notice in writing stating the amount is due to them and we shall not ask for any further proof or evidence and the notice from PFRDA shall be conclusive and binding on us and shall not be questioned by us in any respect or manner whatsoever. We undertake to pay the amount claimed by PFRDA, without protest or demur or without reference to Bidder and notwithstanding any contestation or existence of any dispute whatsoever between Bidder and PFRDA, pay PFRDA forthwith from the date of receipt of the notice as aforesaid. We confirm that our obligation to PFRDA under this guarantee shall be independent of the agreement or agreements or other understandings between PFRDA and _____(Name of the bidder)_____. This guarantee shall not be revoked by us without prior consent in writing of PFRDA.
IV. We hereby further agree that – i. Any forbearance or commission on the part of PFRDA in enforcing the conditions of the said agreement or in compliance with any of the terms and conditions stipulated in the said Bid and/or hereunder or granting of any time or showing of any indulgence by PFRDA to bidder or any other matter in connection therewith shall not discharge us in any way our obligation under this guarantee. This guarantee shall be discharged only by the performance of bidder of their obligations and in the event of their failure to do so, by payment by us of the sum not exceeding Rs. 17,00,000 (Rupees Seventeen Lakhs only).
ii. Our liability under these presents shall not exceed the sum of Rs 17,00,000 (Rupees Seventeen Lakhs only). iii. Our liability under this agreement shall not be affected by any infirmity or irregularity on the part of our said constituents in tendering for the said work or their obligations there under or by dissolution or change in the constitution of our said constituents.
iv. This guarantee shall remain in force for 180 days from the due date of closure of this tender
provided that if so desired by PFRDA, this guarantee shall be renewed for a further period as may be indicated by them on the same terms and conditions as contained herein.
44v. Our liability under these presents will terminate unless these presents are renewed as provided herein after completion of 180 days or on the day when our said constituents comply with their obligations, as to which a certificate in writing by PFRDA alone is the conclusive proof, whichever date is earlier.
vi. Unless demand for claim under this guarantee is made on us in writing on or before _______ (mention claim period with extension, if any), we shall be discharged from all liabilities under this guarantee thereafter.
vii. This guarantee shall be governed by Indian Laws and the Courts in Delhi, India alone shall have the jurisdiction to try & entertain any dispute arising out of this guarantee. viii. We, the Bank also agree that this guarantee will not be discharged due to change in the constitution of the Bank or _____(Name of the purchasing entity).
Notwithstanding anything contained hereinabove: a. Our liability under this Security shall not exceed Rs 17,00,000 (Rupees Seventeen Lakhs only). b. This Security shall be valid up to ………………………. c. We are liable to pay the guaranteed amount or any part thereof under this Security or electronically transferred to the bank account of PFRDA only and only if you serve upon us a written claim or demand on or before …………………… Yours faithfully, (For and on behalf of Authorised official of the bank) (Note: This guarantee will require stamp duty and shall be signed by the official(s) whose signature and authority shall be IV. PERFORMANCE SECURITY FORMAT (INDICATIVE) (TO BE STAMPED AS AN AGREEMENT) Performance Security - TENDER FOR PROPOSED CIVIL, INTERIOR RENOVATION & FURNISHING, ELECTRICAL, HVAC & ALLIED SERVICES WORKS FOR PFRDA REGIONAL OFFICE AT 16TH FLOOR, F-WING, MAKER TOWERS, CUFFE PARADE, MUMBAI - 400 005, MUMBAI (MAHARASHTRA) - Tender Ref. No.- PFRDA/06/12/11/0002/2017-ADMIN, Dated 4th February 2026 THIS DEED OF GUARANTEE executed on this the ___________day of _______ at _______________ by (Name of the Bank) having its Head/Registered office at ______________ (hereinafter referred to 45as “the Guarantor” which expression shall unless it be repugnant to the subject or context thereof include successors and assigns).
In favour of Pension Fund Regulatory and Development Authority (hereinafter referred to as “PFRDA”, which expression shall, unless repugnant to the context or meaning thereof include its administrators, successors or assigns.
WHEREAS a. The Agreement (“AGREEMENT”) dated ________being entered into between PFRDA and _______, a firm / a company incorporated under the provisions of the Companies Act, 2013 having its registered office _____________________________, Successful Bidder, execution of contract under the PROPOSED CIVIL, INTERIOR RENOVATION & FURNISHING, ELECTRICAL, HVAC & ALLIED SERVICES WORKS FOR PFRDA REGIONAL OFFICE AT 16TH FLOOR, F-WING, MAKER TOWERS, CUFFE PARADE, MUMBAI - 400 005, MUMBAI (MAHARASHTRA) (hereinafter referred to as “The Project”).
As per terms of tender, the contractor is required to furnish to PFRDA, an unconditional and irrevocable Performance Security for an amount of INR ___________________ only as security for due and punctual performance/discharge of its obligations under the Agreement relating to execution of contract.
At the request of the Selected Bidder, the Guarantor has agreed to provide Performance Security, being these presents guaranteeing the due and punctual performance/discharge by contractor of its obligations relating to the Project.
NOW THEREFORE THIS DEED WITNESSETH AS FOLLOWS: b. The Guarantor hereby irrevocably guarantees the due and punctual performance by (hereinafter called “the Selected Bidder”) of all its obligations relating to the Project and in connection with execution of the contract by the Selected Bidder, in accordance with the Agreement.
The Guarantor shall, without demur or protest, pay to PFRDA sums not exceeding in aggregate INR_____________________, within ten (10) calendar days of receipt of a written demand therefor from PFRDA stating that the Company has failed to meet its obligations under the Agreement. The Guarantor shall not go into the veracity of any breach or failure on the part of contractor or validity of demand so made by PFRDA and shall pay the amount specified in the demand, notwithstanding any direction to the contrary given or any dispute whatsoever raised by contractor or any other Person. The Guarantor’s obligations hereunder shall subsist until all such demands are duly met and discharged in accordance with the provisions hereof.
In order to give effect to this Guarantee, PFRDA shall be entitled to treat the Guarantor as the principal debtor. The obligations of the Guarantor shall not be affected by any variations in the terms and conditions of the Agreement or other documents or by the extension of time for performance granted to contractor or postponement/non exercise/delayed exercise of any of its rights by PFRDA or any indulgence shown by PFRDA to contractor and the Guarantor shall not be relieved from its obligations under this Guarantee on account of any such variation, extension, postponement, non-exercise, delayed 46exercise of any of its rights by PFRDA or any indulgence shown by PFRDA, provided nothing contained herein shall enlarge the Guarantor’s obligation hereunder.
This Guarantee shall be irrevocable and shall remain in full force and effect until _____________________ (180 days after completion of tenure of contract (including AMC)) unless discharged/released earlier by PFRDA in accordance with the provisions of the Agreement. The Guarantor’s liability in aggregate be limited to a sum of INR.
This Guarantee shall not be affected by any change in the constitution or winding up of the Selected Bidder/the Guarantor or any absorption, merger, or amalgamation of the Concessionaire/the Guarantor with any other Person.
The Guarantor has power to issue this guarantee and discharge the obligations contemplated herein, and the undersigned is duly authorized to execute this Guarantee pursuant to the power granted under_______________.
This guarantee shall be governed by Indian Laws and the Courts in Delhi, India alone shall have the jurisdiction to try & entertain any dispute arising out of this guarantee.
In witness where of the guarantor has set its hands hereunto on the day, month and year first hereinabove written.
This guarantee shall be governed by Indian Laws and the Courts in Delhi, India alone shall have the jurisdiction to try & entertain any dispute arising out of this guarantee.
We, the Bank also agree that this guarantee will not be discharged due to change in the constitution of the Bank or _____ (Name of the purchasing entity).
Notwithstanding anything contained hereinabove: a) Our liability under this Performance Security shall not exceed Rs ___________ b) This Performance Security shall be valid up to _____________ c) We are liable to pay the guaranteed amount or any part thereof under this Performance Security or electronically transferred to the bank account of PFRDA only and only if you serve upon us a written claim or demand on or before _________________ Yours faithfully, (For and on behalf of Authorised official of the bank) (Note: This guarantee will require stamp duty and shall be signed by the official(s) whose signature and authority shall be verified) 47PART - F GENERAL CONDITIONS OF CONTRACT
1.0 Definitions: - “Contract means the documents forming the tender and the acceptance there of and the formal agreement executed between Pension Fund Regulatory and Development Authority (PFRDA)
(client) and the contractor, together with the documents referred there in including these conditions, the specifications, designs, drawings and instructions issued from time to time by the architects/ PFRDA and all these documents taken together shall be deemed to form one contract and shall be complementary to one another.
1.1 In the contract the following expressions shall, unless the context otherwise requires, have the meaning hereby respectively assigned to them.
1.1.1 ‘PFRDA shall mean Pension Fund Regulatory and Development Authority (client) a body Corporate created under Pension Fund Regulatory and Development Authority relevant Act, having its Head office at E-500, Tower E, 5th Floor World Trade Centre, Nauroji Nagar New Delhi - 110029 and includes the client’s representatives, successors and assigns.
Architects/ Consultants’ shall mean M/s Shetgiri & Associates, Mumbai.
1.1.2 ‘Site Engineer’ shall mean an Engineer appointed by the PFRDA at site as their representative for day-to-day supervision of work and to give instructions to the contractors.
1.1.3 ‘The Contractor’ shall mean the individual or firm or company whether incorporate not, undertaking the works and shall include legal personal representative of individual or the composing the firm or company and the permitted assignees of individual or firms of company.
The expression ‘works’ or ‘work’ shall mean the permanent or temporary work description in the “Scope of work” and / or to be executed in accordance with the contract includes materials, apparatus, equipment, temporary supports, fittings and things of kinds to be provided, the obligations of the contractor hereunder and work to be done by the contractor under the contract.
1.1.4 ‘Engineer’ shall mean the representative of the Architect/consultant.
1.1.5 ‘Drawings’ shall mean the drawings prepared by the Architects and issued by the Engineer and referred to in the specifications and any modifications of such drawings as may be issued by the Engineer from time to time ‘Contract value shall mean value of the entire work as stipulated in the letter of acceptance of tender subject such additions there to or deductions there from as may be made under the provide herein after contained.
1.1.6 ‘Specifications’ shall mean the specifications referred to in the tender and any modifications thereof as may time to time be furnished or approved by the architect/ consultant “Month” means calendar month.
1.1.7 “Week” means seven consecutive days.
1.1.8 “Day” means a calendar day beginning and ending at 00 Hrs and 24 Hrs respectively.
482.0 Deposits: - a) Earnest Money Deposit - The bidder shall furnish EMD of Rs. 17,00,000 (Rupees Seventeen Lakhs only) to be transferred electronically to PFRDA designated Bank Account or in the form of Account payee demand draft in favour of Pension Fund Regulatory and Development Authority, New Delhi or in the form of Bank Guarantee. No tender shall be considered unless the EMD is so deposited in the required form. No interest shall be paid on this EMD. The EMD of the unsuccessful bidder shall be refunded soon after the decision to award the contract is taken without interest. The EMD shall stand absolutely forfeited if the bidder revokes his tender at any time during the period when he is required to keep his tender open acceptance by the PFRDA or after it is accepted by the PFRDA the contractor falls to enter into a formal agreement or fails to pay the performance security as stipulated or fails to commence the work within the stipulated time.
b) Performance Security The successful bidder(s) shall be responsible to submit Performance Security @ 5% of the Contract
Value which can be in any of the following form: a) Performance Bank Guarantee (BG) which should be valid up to 180 days from the date of completion of the contract. The successful bidder shall extend the Performance Security depending on the extension of the Contract period.
(Or) b) Performance Security may also be submitted in the form of Fixed Deposit Receipt issued by a Scheduled Commercial bank lien marked in favour of PFRDA and should be valid up to 180 days from the date of completion of the contract from the successful Bidder. The successful bidder shall extend the fixed deposit depending on the extension of the Contract period.
(Or) c) Performance Security may also be transferred electronically to PFRDA designated Bank Account as mentioned above.
EMD will be returned on receipt of Performance Security. c) Security Deposit / Retention Money: - Security Deposit / Retention Money shall be deducted from each running/final bill of the contractor at the rate of 5% of gross value of running account/final bill. The initial 50% of the total Security Deposit shall be paid to the contractor on the basis of Architect’s certifying the virtual completion.
The balance 50% would be paid to the contractors after the defects liability period as specified in the contract.
3.0 Language Errors, omissions and discrepancies In case of errors, omissions and/ or disagreement between written and scaled dimensions on the drawings or between the drawings and specifications etc., the following order shall apply.
i) Between scaled and written dimension (or description) on a drawing, the latter shall be adopted. ii) Between the written or shown description or dimensions in the drawings and the corresponding one in the specification the former shall be taken as correct.
iii) Between written description of the item in the specifications and descriptions in bills of quantities of the same item, the former shall be adopted:
49iv) In case of difference between rates written in figures and words, the rate in words shall prevail. v) Between the duplicate / subsequent copies of the tender, the original tender shall be taken as correct.
4.0 Scope of Work:
The contractor shall carry out, complete and maintain the said work in every respect strictly in accordance with this contract and with the directions of and to the satisfaction of the PFRDA to be communicated through the architect/consultant. The architect/consultant at the directions of the PFRDA from time to time issue further drawings and/or written instructions, details directions and explanations which are hereafter collectively referred to as Architect’s/Consultant’s instructions in
regard to : the variation or modification of the design, quality or quantity of work or the addition or omission or substitution of any work, any discrepancy in the drawings or between the BOQ and/or drawings and/or specifications, the removal from the site of any material brought thereon by the contractor and the substitution of any other materials thereof, the demolition, removal and/or re- execution of any work executed by him, the dismissal from the work of any person employed/engaged thereupon.
5. (i) Letter of Acceptance:
Within the validity period of the tender the PFRDA shall issue a letter of acceptance either directly or through the architect by registered post or otherwise depositing at the address of the contractor as given in the tender to enter into a Contract for the execution of the work as per the terms of the tender. The letter of acceptance shall constitute a binding contract between the PFRDA and the contractor.
5.(ii) Contract Agreement:
On receipt of intimation of the acceptance of tender from the PFRDA/Architect the successful bidder shall be bound to implement the contract and within fifteen days thereof he shall sign an agreement in a non-judicial stamp paper of appropriate value.
6.0 Ownership of drawings:
All drawings, specifications and copies thereof furnished by the PFRDA through its architect/ consultants are the properties of the PFRDA. They are not to be used on other work.
7.0 Detailed drawings and instructions:
The PFRDA through its architects/consultants shall furnish with reasonable promptness additional instructions by means of drawings or otherwise necessary for the proper execution of the work. All such drawings and instructions shall be consistent with the contract documents, true developments thereof and reasonably inferable there from.
The work shall be executed in conformity therewith and the contractor prepare a detailed programme schedule indicating therein the date of start and completion of various activities on receipt of the work order and submit the same to the PFRDA through the Architect/Consultant.
Copies of agreement Two copies of agreement duly signed by both the parties with the drawings shall be handed over to the contractors.
508.0 Liquidated damages:
If the contractor fails to maintain the required progress in terms ofthe relevant clause of GCC or to complete the work and clear the site including vacating their office on or before the contracted or extended date or completion without justification in support of the cause of delay, he may be called upon without prejudice to any other right of remedy available under the law to the PFRDA on account of such breach to pay a liquidated damages at the rate of 0.5% of the contract value per week subject to a maximum of 5% of the contract value.
9.0 Materials, Appliances and Employees Unless or otherwise specified the contractor shall provide and pay for all materials, labour, water, power, tools, equipment transportation and any other facilities that are required for the satisfactory execution and completion of the work. Unless or otherwise specified all materials shall be new and both workmanship and materials shall be best quality. The contractor shall at all times enforce strict discipline and good order among his employees and shall not employ on the work any unfit person or anyone not skilled in the work assigned to him. Workman whose work or behaviour is found to be unsatisfactory by the PFRDA/Architect/Consultant he shall be removed from the site immediately.
10.0 Permits, Laws and Regulations:
Permits and licences required for the execution of the work shall be obtained by the contractor at his own expenses.
The contractor shall give notices and comply with the regulations, laws, and ordinances rules, applicable to the contractor. If the contractor observes any discrepancy between the drawings and specifications, he shall promptly notify the PFRDA in writing under intimation of the Architect/Consultant. If the contractor performs any act which is against the law, rules and regulations he shall meet all the costs arising there from and shall indemnify the PFRDA any legal actions arising there from..
11.0 Setting out Work:
The contractor shall set out the work and shall be responsible for the true and perfect setting out of the same and for the correctness of the positions, levels, dimensions, and alignment of all parts thereof and get it approved by the architect/consultant before proceeding with the work. If at any time any error in this respect shall appear during the progress of the works, irrespective of the fact that the layout had been approved by the architect/consultant the contractor shall be responsible for the same and shall at his own expenses rectify such error, if so, required to satisfaction of the PFRDA.
12.0 Protection of works and property:
The contractor shall continuously maintain adequate protection, of all his work from damage and shall protect the PFRDA properties from injury or loss arising in connection with contract. He shall make good any such damage, injury, loss due to his fault or negligence except which are due to causes beyond his control.
He shall take adequate care and steps for protection of the adjacent properties. The contractor shall take all precautions for safety and protection of his employees on the works and shall comply with 51all applicable provisions of Government and local bodies’ safety laws and building codes to prevent accidents, or injuries to persons or property of about or adjacent to his place of work. The contractor shall take insurance covers as per the relevant clause at his own cost. The policy may be taken in joint names of the contractors and the PFRDA and the original policy may be lodged with the PFRDA.
13.0 Inspection of work:
The PFRDA/Architect/Consultant or their representatives shall at all reasonable time have free access to the work site and/or to the workshop, factories or other places where materials are lying or from where they are obtained and the contractor shall give every facility to the PFRDA, Architect/Consultant and their representatives necessary for inspection and examination and test of the materials and workmanship. No person unless authorized by the PFRDA/Architect/Consultant except the representative of Public authorities shall be allowed on the work at any time. The proposed work either during its construction stage or its completion can also be inspected by the Chief Technical Examiner’s organization a wing of Central Vigilance Commission.
14.0 Assignment and subletting The whole of work included in the contract shall be executed by the contractor and he shall not directly entrust and engage or indirectly transfer assign or underlet the contract or any part or share thereof or interest therein without the written consent of the PFRDA through the architect and no undertaken shall relieve the contractor from the responsibility of the contractor from active superintendence of the work during its progress.
15.0 Quality of materials, workmanship & Test
(i) All materials and workmanship shall be best of the respective kinds described in the contract and in accordance with Architect/Consultant instructions and shall be subject from time to time to such tests as the architect/consultant may direct at the place of manufacture or fabrication or on the site or an approved testing laboratory. The contractor shall provide such assistance, instruments, machinery, labour and materials ii) Samples All samples of adequate numbers, size, shades & pattern as per specifications shall be supplied by the contractor without any extra charges. If certain items proposed to be used are of such nature that samples cannot be presented or prepared at the site detailed literature/test certificate of the same shall be provided to the satisfaction of the Architect/ consultant. Before submitting the sample/literature the contractor shall satisfy himself that the material/equipment for which he is submitting the samples/literature meet with the requirement of tender specification. Only when the samples are approved in writing by the architect/consultant the contractor shall proceed with the procurement and installation of the particular material/equipment. The approved samples shall be signed by the Architect/Consultant for identification and shall be kept on record at site office until the completion of the work for inspection/comparison at any time. The Architect/Consultant shall take reasonable time to approve the sample. Any delay that might occur in approving the samples for reasons of its not meeting the specifications or other discrepancies inadequacy in furnishing samples of best qualities from various manufacturers and such other aspects causing delay on the approval of the materials / equipment etc shall be to the account of the contractor.
iii) Cost of tests 52The cost of making any test shall be borne by the contractor if such test is intended by or provided for in the specification or BOQ. iv) Costs of tests not provided for If any test is ordered by the Architect/ Consultant which is either:
If so intended by or provided for or ( in the cases above mentioned) is not so particularized or through so intended or provided for but ordered by the Architect/Consultant which is either to be carried out by an independent person at any place other than the site or the place of manufacture or fabrication of the materials tested or any Government/approved laboratory, then the cost of such test shall be borne by the contractor.
16.0 Obtaining information related to execution of work No claim by the contractor for additional payment shall be entertained which is consequent upon failure on his part to obtain correct information as to any matter affecting the execution of the work nor any misunderstanding or the obtaining incorrect information or the failure to obtain correct information relieve him from any risks or from the entire responsibility for the fulfilment of contract.
17.0 Contractor’s superintendence The contractor shall give necessary personal superintendence during the execution of the works and as long, thereafter, as the Architect/consultant may consider necessary until the expiry of the defects liability period, stated hereto.
18.0 Quantities i)The bill of quantities (BOQ) unless or otherwise stated shall be deemed to have been prepared in accordance with the Indian Standard Method of Measurements.
The rate quoted shall remain valid for variation of quantity against individual item to any extent subject to maximum variation of the contract value by 25%. The entire amount paid under the relevant Clause hereof as well as amounts of prime cost and provisional sums, if any, shall be excluded.
ii)Variation exceeding 25%: The items of work executed in relation to variation exceeding 25% shall be paid on the basis of provisions of the relevant clause hereof.
19.0 Works to be measured The Architect/Consultant may from time to time intimate to the contractor that he required the work to be measured and the contractor shall forthwith attend or send a qualified representative to assist the Architect in taking such measurements and calculation and to furnish all particulars or to give all assistance required by any of them. Such measurements shall be taken in accordance with the Mode of measurements detailed in the specifications. The representative of the Architect/Consultant shall take joint measurements with the contractor’s representative and the measurements shall be entered in the measurement book. The contractor or his authorized representative shall sign all the pages of the measurement book in which the measurements have been recorded in token of his acceptance.
All the corrections shall be duly attested by both representatives. No over writings shall be made in the M book. Should the contractor not attend or neglect or omit to depute his representative to take 53measurements then the measurements recorded by the representative of the Architect/consultant shall be final. All authorized extra work, omissions and all variations made shall be included in such measurements.
20.0 Variations No alteration, omission or variation ordered in writing by the Architect/Consultant shall vitiate the contract.
In case the PFRDA/Architect/Consultant thinks proper at any time during the progress of works to make any alteration in, or additions to or omission from the works or any alteration in the kind or quality of the materials to be used therein, the Architect/Consultant shall give notice thereof in writing to the contractor or shall confirm in writing within seven days of giving such oral instructions the contractor shall alter to, add to, or omit from as the case may be in accordance with such notice but the contractor shall not do any work extra to or make any alteration or additions to or omissions from the works or any deviation from any of the provisions of the contract, stipulations, specifications or contract drawings without previous consent in writing of the Architect/Consultant and the value of such extras, alterations, additions or omissions shall in all cases be determined by the Architect/Consultant and the same shall be added to or deducted from the contract value, as the case may be.
21.0 Valuation of Variations No claim for an extra shall be allowed unless it shall have been executed under the authority of the Architect/Consultant with the concurrence of the PFRDA as herein mentioned. Any such extra is herein referred to as authorized extra and shall be made in accordance with the following provisions.
a) The net rates or prices in the contract shall determine the valuation of the extra work where such extra work is of similar character and executed under similar conditions as the work priced herein.
Rates for all items, wherever possible should be derived out of the rates given in the priced BOQ b) The net prices of the original tender shall determine the value of the items omitted, provided if omissions do not vary the conditions under which any remaining items of works are carried out, otherwise the prices for the same shall be valued under sub relevant clause here under.
c) Where the extra works are not of similar character and/or executed under similar conditions as aforesaid or where the omissions vary the conditions under which any remaining items or works are carried out, then the contractor shall within 7 days of the receipt of the letter of acceptance inform the Architect/Consultant of the rate which he intends to charge for such items of work, duly supported by analysis of the rate or rates claimed and the Architect/Consultant shall fix such rate or prices as in the circumstances in his opinion are reasonable and proper, based on the market rate.
d) Where extra work cannot be properly measured or valued the contractor shall be allowed day work prices at the net rates stated in the tender of the BOQ or, if not, so stated then in accordance with the local day work rates and wages for the district; provided that in either case, vouchers specifying the daily time (and if required by the Architect/Consultant) the workman’s name and materials employed be delivered for verifications to the Architect/Consultant at or before the end of the week following that in which the work has been executed.
e) It is further clarified that for all such authorized extra items where rates cannot be derived from the tender, the contractor shall submit rates duly supported by rate analysis worked on the “market rate basis” for material, labour, hire/running charges of equipment and wastages etc plus 15% 54towards establishment charges, contractor’s overheads and profit. Such items shall not be eligible for escalation.
22.0 Final measurement The measurement and valuation in respect of the contract shall be completed within six months of the virtual completion of the work.
23.0 Virtual Completion Certificate (VCC) On successful completion of entire works covered by the contract to the full satisfaction of the PFRDA, the contractor shall ensure that the following works have been completed the satisfaction of PFRDA.
a) Clear the site of all scaffolding, wiring, pipes, surplus materials, contractor’s labour equipment and machinery. b) Demolish, dismantle and remove the contractor’s site office, temporary works, structure including labour sheds/camps and constructions and other items and things whatsoever brought upon or erected at the site or any land allotted to the contractor by the PFRDA not incorporated in the permanent works.
c) Remove all rubbish, debris etc. from the site and the land allotted to the contractor the PFRDA and shall clear, level and dress, compact the site as required by the PFRDA. d) Shall put the PFRDA in undisputed custody and possession of the site and all land allot by the PFRDA.
e) Shall hand over the work in a peaceful manner to the PFRDA. f) All defects / imperfections have been attended and rectified as pointed out by the Architects to the full satisfaction of PFRDA.
Upon the satisfactory fulfilment by the contractor as stated above, the contractor shall be entitled to apply to the Architect/Consultant for the certificate. If the Architect/Consultant is satisfied of the completion of the work, relative to which the completion certificate has been sought, the Architect/Consultant shall within fourteen (14) days of the receipt of the application for virtual completion certificate, issue a VCC in respect of the work for which the VCC has been applied.
This issuance of a VCC shall be without prejudice to the PFRDA rights and contractor’s liabilities under the contract including the contractor’s liability for defects liability period nor shall the issuance of VCC in respect of the works or work at any site be construed as a waiver of any right or claim of the PFRDA against the contractor in respect of works or work at the site and in respect of which the VCC has been issued.
24.0 Work by other agencies The PFRDA/Architect/Consultant reserves the rights to use premises and any portion of the site for execution of any work not included in the scope of this contract which it may desire to have carried out by other persons simultaneously and the contractor shall not only allow but also extend 55reasonable facilities for the execution of such work. The contractor however shall not be required to provide any plant or material for the execution of such work except by special arrangement with the PFRDA. Such work shall be carried out in such manners not to impede the progress of the works included in the contract.
25.0 Insurance of works
25.1 Without limiting his obligations and responsibilities under the contract the contractor shall insure in the joint names of the PFRDA and the contractor against all loss or damages from whatever cause arising other than the excepted risks, for which he is responsible under the terms of contract and in such a manner that the PFRDA and contractor are covered for the period stipulated in the relevant clause of GCC and are also covered during the period of maintenance for loss or damage arising from a cause, occurring prior to the commencement of the period of maintenance and for any loss or damage occasioned by the contractor in the course of any operations carried out by him for the purpose of complying with his obligations under relevant clause.
a) The Works for the time being executed to the estimated current Contract value thereof, or such additional sum as may be specified together with the materials for incorporation in the works at their replacement value.
b) The constructional plant and other things brought on to the site by the contractor to the replacement value of such constructional plant and other things. c) Such insurance shall be effected with an insurer and in terms approved by the PFRDA which approval shall not be unreasonably withheld and the contractor shall whenever required produce to the Architect / consultant the policy if insurance and the receipts for payment of the current premiums.
25.2 Damage to persons and property The contractor shall, except if and so far as the contract provides otherwise indemnify the PFRDA against all losses and claims in respect of injuries or damages to any person or material or physical damage to any property whatsoever which may arise out of or in consequence of the execution and maintenance of the works and against all claims proceedings, damages, costs, charges and expenses whatsoever in respect of or in relation thereto except any compensation of damages for or with
respect to : a) The permanent use or occupation of land by or any part thereof. b) The right of PFRDA to execute the works or any part thereof on, over, under, in or through any lands. c) Injuries or damages to persons or properties which are unavoidable result of the execution or maintenance of the works in accordance with the contract d) Injuries or damage to persons or property resulting from any act or neglect of the PFRDA their agents, employees or other contractors not being employed by the contractor or for or in respect of any claims, proceedings, damages, costs, charges and expenses in respect thereof or in relation thereto or where the injury or damage was contributed to by the contractor, his servants or agents such part of the compensation as may be just and equitable having regard to the extent of the 56responsibility of the PFRDA, their employees, or agents or other employees, or agents or other contractors for the damage or injury.
25.3 Contractor to indemnify PFRDA The contractor shall indemnify the PFRDA against all claims, proceedings, damages, costs, charges and expenses in respect of the matters referred to in the provision of the relevant clause.
25.4 Contractor’s superintendence The contractor shall fully indemnify and keep indemnified the PFRDA against any action, claim, or proceeding relating to infringement or use of any patent or design or any alleged patent or design rights and shall pay any royalties which may be payable in respect of any article or part thereof included in the contract. In the event of any claim made under or action brought against PFRDA in respect of such matters as aforesaid the contractor shall be immediately notified thereof and the contractor shall be at liberty, at his own expenses to settle any dispute or to conduct any litigation that may arise there from, provided that the contractor shall not be liable to indemnify the PFRDA if the infringement of the patent or design or any alleged patent or design right is the direct result of an order passed by the Architect/Consultant in this behalf.
25.5 Third Party Insurance
25.5.1 The contractors under the terms of the contract are required to keep the works duly insured under CAR Policy (Contractor All Risk Policy) as well as third Party Insurance for minimum value of Rs.
20 Lakhs until the Completion of the project or handing over whichever is later. The PFRDA shall ensure that proper insurance policies are taken in the joint names by the contractors and the same are renewed at appropriate time. The policies taken out by the contractor shall be kept in safe custody of the concerned Department of the PFRDA. The Site Engineer/PMC shall ensure that insurance policies are in order while certifying the contractor's bills. The concerned Department of the PFRDA shall also verify at the time of releasing payments to the contractors.
Before commencing the execution of the work the contractor but without limiting his obligations and responsibilities under the relevant clause of GCC shall insure against his liability for any material or physical damage, loss, or injury which may occur to any property including that of PFRDA, or to any person, including any employee of the PFRDA, by or arising out of the execution of the works or in the carrying out of the contract, otherwise than due to the matters referred to in the provision to the said clause thereof.
25.5.2 Minimum amount of Third Party Insurance Such insurance shall be affected with an insurer and in terms approved by the PFRDA which approval shall not be reasonably withheld and for at least the amount stated below. The contractor shall, whenever required, produce to the Architect/Consultant the policy or policies of insurance cover and receipts for payment of the current premiums.
25.6 The minimum insurance cover for physical property, injury, and death is Rs. 20.00 lacs per occurrence with the number of occurrences limited to four. After each occurrence contractor will pay additional premium necessary to make insurance valid for four occurrences always.
25.7 Accident or Injury to workman:
5725.7.1 The PFRDA shall not be liable for or in respect of any damages or compensation payable at law in respect or in consequence of any accident or injury to any workmen or other person in the employment of the contractor or any sub-contractor, save and except an accident or injury resulting from any act or default of the PFRDA or their agents, or employees. The contractor shall indemnify and keep indemnified PFRDA against all such damages and compensation, save and except as aforesaid and against all claims, proceedings, costs, charges and expenses whatsoever in respect thereof or in relation thereto.
25.7.2 Insurance against accidents etc. to workmen The contractor shall insure against such liability with an insurer approved by the PFRDA during the whole of the time any person employed by him on the works and shall, when required, produce to the architect/consultant such policy of insurance and receipt for payment of the current premium.
Provided always that, in respect of any persons employed by any sub-contractor the contractor’s obligation to insure as aforesaid under this sub-clause shall be satisfied if the sub contractor shall have insured against the liability in respect of such persons in such manner that PFRDA is indemnified under the policy but the contractor shall require such sub-contractor to produce to the Architect/Consultant when required such policy of insurance and the receipt for the payment of the current premium.
25.7.3 Remedy on contractor’s failure to insure If the contractor fails to effect and keep in force the insurance referred to above or any other insurance which he may be required to effect under the terms of contract, then and in any such case the PFRDA may effect and keep in force any such insurance and pay such premium or premiums as may be necessary for that purpose and from time to time deduct the amount so paid by the PFRDA as aforesaid and also deduct 15% of contract value from any amount due or which may become due to the contractor, or recover the same as debt from the contractor.
25.7.4 Without prejudice to the other rights of the PFRDA against contractors in respect of such default, the PFRDA shall be entitled to deduct from any sums payable to the contractor the amount of any damages costs, charges, and other expenses paid by the PFRDA and which are payable by the contractors under this clause. The contractor shall upon settlement by the insurer of any claim made against the insurer pursuant to a policy taken under this clause, proceed with due diligence to rebuild or repair the works destroyed or damaged. In this event all the monies received from the insurer in respect of such damage shall be paid to the contractor and the contractor shall not be entitled to any further payment in respect of the expenditure incurred for rebuilding or repairing of the materials or goods destroyed or damaged.
26.0 Commencement of Works:
The date of commencement of the work will be reckoned as the recorded date of handing over site by the PFRDA or 15 days from the date of issue of Letter of Acceptance of PFRDA, whichever is later.
27.0 Time for completion Time is essence of the contract and shall be strictly observed by the contractor. The entire work shall be completed within a period of 2 months (60 days) from the date of commencement. If required in the contract or as directed by the Architect / consultant the contractor shall complete certain portions of work before completion of the entire work. However, the completion date shall be reckoned as the date by which the whole work is completed as per the terms of the contract.
5828.0 Extension of time If, in the opinion of the Architect/Consultant, the work be delayed for reasons beyond the control of the contractor, the Architect/Consultant may submit a recommendation to the PFRDA to grant a fair and reasonable extension of time for completion of work as per the terms of contract. If the contractor needs an extension of time for the completion of work or if the completion of work is likely to be delayed for any reasons beyond the due date of completion as stipulated in the contract, the contractor shall apply to the PFRDA through the Architect/Consultant in writing at least 30 days before the expiry of the scheduled time and while applying for extension of time he shall furnish the reasons in detail and his justification if any, for the delays. The architect/consultant shall submit their recommendations to the PFRDA in the prescribed format for granting extension of time. While granting extension of time the contractor shall be informed the period extended time which will qualify for levy of liquidated damages. For the balance period in excess of original stipulated period and duly sanctioned extension of time by the PFRDA the provision of liquidated damages as stated under the relevant clause of GCC shall become applicable. Further contract shall remain in force even for the period beyond the due date of completion irrespective whether the extension is granted or not.
29.0 Rate of progress Whole of the materials, plant and labour to be provided by the contractor and the mode, manner and speed of execution and maintenance of the works are to be of a kind and conducted in a manner to the satisfaction of the Architect/Consultant. Should the rate of progress of the work or any part thereof be at any time be in the opinion of the Architect/ Consultant too slow to ensure the completion of the whole of the work by the prescribed time or extended time for completion the Architect/Consultant shall thereupon take such steps as considered necessary by the Architect/Consultant to expedite progress so as to complete the woks by the prescribed time or extended time. Such communications from the Architect/Consultant neither shall the relieve the contractor from fulfilling obligations under the contract nor he shall be entitled to raise any claims arising out of such directions.
30.0 Work during nights and holidays Subject to any provision to the contrary contained in the contract no permanent work shall save as herein provided be carried on during the night or on holidays without the permission in writing of the Architect/Consultant, save when the work is unavoidable or absolutely necessary for the saving of life or property or for the safety of the work in which case the contractor shall immediately advise the Architect/Consultant. However, the provision of the clause shall not be applicable in the case of any work which becomes essential to carry by rotation or double shifts in order to achieve the progress and quality of the part of the works being technically required and continued with the prior approval of the Architect/consultant at no extra cost to the PFRDA.
All work at night after obtaining approval from competent authorities shall be carried out without unreasonable noise and disturbance.
31.0 No compensation or restrictions of work If at any time after acceptance of the tender PFRDA shall decide to abandon or reduce the scope of work for any reason whatsoever and hence not required the whole or any part of the work to be carried out. The Architect / consultant shall give notice in writing to that effect to the contractor and 59the contractor shall act accordingly in the matter. The contractor shall have no claim to any payment of compensation or otherwise what so ever on account of any profit or advantage which he might have derived from the execution of the Work fully but which he did not derive in consequence of the foreclosure of the whole or part of the work.
Provided that the contractor shall be paid the charges on the cartage only of materials actually and bona fide brought to the site of the work by the contractor and rendered surplus as a result of the abandonment, curtailment of the work or any portion thereof and then taken back by the contractor,
provided however that the Architect/Consultant shall have in such cases the option of taking over all or any such materials at their purchase price or a local current rate whichever is less.
In case of such stores having been issued from PFRDA stores and returned by the contractor to stores, credit shall be given to him at the rates not exceeding those at which were originally issued to the contractor after taking into consideration and deduction for claims on account of any deterioration or damage while in the custody of the contractor and in this respect the decision of Architect/Consultant shall be final.
32.0 Suspension of work The contractor shall, on receipt of the order in writing of the PFRDA/ Architect / consultant (whose decision shall be final and binding on the contractor) suspend the progress of works or any part thereof for such time and in such manner as Architect /consultant may consider necessary so as not to cause any damage or injury to the work already done or endanger the safety thereof for any of
following reasons: a) On account any default on the part of the contractor, or b) For proper execution of the works or part thereof for reasons other than the default the contractor, or c) For safety of the works or part thereof.
The contractor shall, during such suspension, properly protect and secure the works the extent necessary and carry out the instructions given in that behalf by the PFRDA/Architect / consultant.
If the suspension is ordered for reasons (b) and (c) in sub-para (i) above:
The contractor shall be entitled to an extension of time equal to the period of every such suspension.
No compensation whatsoever shall be paid on this account.
33 Action when the whole security deposit is forfeited In any case in which under any clause or clauses of this contract, the Contractor shall have rendered himself liable to pay compensation amounting to the whole of his security deposit the Architect/Consultant shall have the power to adopt any of the following course as they may deem
best suited to the interest of the PFRDA: a) To rescind the contract (of which rescission notice in writing to the contractor by - Architect / consultant shall be conclusive evidence) and in which case the security deposit of the contractor shall be forfeited and be absolutely at the disposal of PFRDA.
b) To employ labour paid by the PFRDA and to supply materials to carry out the work, or part of the work, debiting the contractor with the cost of the labour and materials cost of such labour and 60materials as worked out by the Architect/consultant shall final and conclusive against the contractor) and crediting him with the value of the work done, in all respects in the same manner and at the same manner and at the same rates as if it had been carried out by the contractor under the terms of this contract certificate of architect /consultant as to the value of work done shall be final conclusive against the contractor.
c) To measure up the work of the contractor, and to take such part thereof as shall be unexecuted, out of his hands, and to give it to another contractor to complete in which case any expenses which may be incurred in excess of the sum which would have been paid to the original contractor, if the whole work had been executed by him ( The amount of which excess the certificates in writing of the Architects / consultant shall final and conclusive) shall be borne by original contractor and may be deducted f any money due to him by PFRDA under the contract or otherwise, or from his security deposit or the proceeds of sale thereof, or sufficient part thereof.
In the event of any of above courses being adopted by the PFRDA the contractor shall have no claim to compensation for any loss sustained by him by reasons of his having purchased or procured any material or entered into any engagements or make any advances on account of, or with a view to the execution of the work or the performance of the contract and in case the contract shall be rescinded under the provision aforesaid, the contractor shall not be entitled to recover or to be paid any sum or any work thereto for actually performed under this contract, unless, and until the Architect/Consultant will have certified in writing the performance of such work and the value payable in respect thereof, and he shall only be entitled to be paid the value so certified.
34.0 Owner’s right to terminate the contract If the contractor being an individual or a firm commit any ‘Act of Insolvency’ or shall be adjudged an insolvent or being an incorporated company shall have an order for compulsory winding up voluntarily or subject to the supervision of Government and of the Official Assignee of the liquidator in such acts of insolvency or winding up shall be called upon within seven days after notice to him to do so, to show to the reasonable satisfaction of the Architect/Consultant that he is able to carry out and fulfil the contract, and provide security therefore if so required by the Architect/Consultant.
Or if the contractor (whether an individual firm or incorporated Company) shall suffer execution to be issued or shall suffer any payment under this contract to be attached by or on behalf of any of the creditors of the contractor.
Or shall assign or sublet this contract without the consent in writing of the PFRDA through the Architect/Consultant or shall charge or encumber this contract or any payment due to which may
become due to the contractor there under: a) Has abandoned the contract; or b) Has failed to commence the works, or has without any lawful excuse under these conditions suspended the progress of the works for 14 days after receiving from the PFRDA through the Architect / consultant written notice to proceed, or c) Has failed to proceed with the works with such diligence and failed to make such due progress as would enable the works to be completed within the time agreed upon, or has failed to remove the materials from the site or to pull down and replace work within seven days after written notice from the PFRDA through the Architect/ Consultant that the said materials were condemned and rejected by the Architect/ Consultant under these conditions; or has neglected or failed persistently to observe and perform all or any of the acts, matters or things by this contract to be observed and performed 61by the contractor for seven days after written notice shall have been given to the contractor to observe or perform the same or has to the detriment of good workmanship or in defiance of the PFRDA or Architect’s/Consultant’s instructions to the contrary subject any part of the contract. Then and in any of said cases the PFRDA and or the Architect/Consultant, may not withstanding any previous waiver, after giving seven days’ notice in writing to the contractor, determine the contract, but without thereby affecting the powers of the PFRDA or the Architect/Consultant or the obligation and liabilities of the contractor the whole of which shall continue in force as fully as if the contract had not been so determined and as if the works subsequently had been executed by or on behalf of the contractor. And, further the PFRDA through the Architect/Consultant, their agents or employees may enter upon and take possession of the work and all plants, tools, scaffoldings, materials, sheds, machineries lying upon the premises or on the adjoining lands or roads, use the same by means of their own employees or workmen in carrying on and completing the work or by engaging any other contractors or persons to complete the work and the contractor shall not in any interrupt or do any act, matter or thing to prevent or hinder such other contractor or other persons employed for completing and finishing or using the materials and plant for the works.
When the works shall be completed or as soon thereafter as convenient the PFRDA or the Architect/Consultant shall give a notice in writing to the contractor to remove his surplus materials and plants and should the contractor fail to do so within 14 days after receipt thereof by him PFRDA can sell the same by public auction after due publication and shall adjust the amount realized by such auction. The contractor shall have no right to question any of the act of the PFRDA incidental to the sale of the materials etc.
35.0 Certificate of payment The contractor shall be entitled under the certificates to be issued by the Architect/ Consultant to the contractor within 10 working days from the date of certificate to the payment from PFRDA from time to time. PFRDA shall recover the statutory recoveries and other dues including the retention amount from the certificate of payment.
Provided always that the issue of any certificate by the Architect/Consultant during the progress of works or completion shall not have effect as certificate of satisfaction or relieve the contractor from his liability under clause.
The Architect/Consultant shall have power to withhold the certificate if the work or any part thereof is not carried out to their satisfaction.
The Architect/Consultant may by any certificate make any corrections required in previous certificate.
PFRDA shall modify the certificate of payment as issued by the Architect/Consultant from time to time while making the payment.
The contractor shall submit interim bills only after taking actual measurements and properly recorded in the Measurement book (M.B).
The Contractor shall not submit interim bills when the approximate value of work done by him is less than Rs.75.00 Lakhs.
62The final bill may be submitted by contractor within a period of one month from the date of virtual completion and Architect/Consultant shall issue the certificate of payment within a period of two months. The PFRDA shall pay the amount within a period of three months from the date of issue of certificate provided there is no dispute in respect of rates and quantities.
The contractor shall submit the interim bills in the prescribed format with all details.
36.0 A. Settlement of Disputes and Arbitration post award of contract Any and all disputes between the Parties arising out of or in connection with this Contract, or its performance, or touching any aspect thereof shall, so far as possible, be settled amicably among the parties. In case the Parties fail to reach an amicable settlement, any and all disputes between the Parties arising out of or in connection with this contract or its performance, or touching any aspect thereof shall be settled by way of arbitration to be conducted under the provisions of the Arbitration and Conciliation Act, 1996, as amended from time to time, by a sole arbitrator to be appointed with the consent of both the parties. Failing any agreement to appoint a sole arbitrator as aforesaid, each party shall appoint one arbitrator, and the two appointed arbitrators shall appoint a third arbitrator, who shall act as the presiding arbitrator. Any further proceedings out of or in relation to such arbitration proceedings, which either party to this agreement may wish to initiate against the other, shall be instituted in courts at New Delhi only.
The successful bidder shall continue work under the Contract during the arbitration proceedings unless otherwise directed by PFRDA or unless the matter is such that the work cannot possibly be continued until the decision of the arbitrator is obtained.
Arbitration proceeding shall be held in Delhi, India, and the language of the arbitration proceedings and that of all documents and communications between the parties shall be in English.
Subject to the arbitration clause, only the Courts at New Delhi shall have exclusive jurisdiction to try any disputes arising between the parties, under this contract or touching any aspect thereof.
37.0 Power Supply The contractor shall make his own arrangements for power and supply/distribution system for driving plant or machinery for the work and for lighting purpose at his own cost. The cost of running and maintenance of the plants are to be included in his tender prices. He shall pay all fees and charges required for the power supply and include the same in his tendered rates and hold the owner free from all such costs. He has to obtain necessary approval from the appropriate authorities, if required.
38.0 Water supply The contractor shall make his own arrangements for water required for the work and nothing extra will be paid for the same. This will be subject to the following conditions: i) That the water used by the contractor shall be fit for construction purposes to the satisfaction of the Architect / consultant’s.
ii) The contractor shall make alternative arrangements for the supply of water if the arrangement made by the contractor for procurement of water in the opinion of the Architect / consultant is unsatisfactory.
39.0 Treasure trove etc.
63Any treasure trove, coin or object antique which may be found on the site shall be the property of PFRDA and shall be handed over to the PFRDA immediately.
40.0 Method of measurement Unless otherwise mentioned in the Bill of Quantities or in mode of measurement, the measurement will be on the net quantities or work produced in accordance with up to date. Rules laid down by the Bureau of Indian Standards. In the event any dispute/disagreement the decision of the Architect/Consultant shall be final and binding on the contractor.
41.0 Maintenance of registers The contractor shall maintain the following registers as per the enclosed perform at site of work and should produce the same for inspection of PFRDA architect / consultant whenever desired by them.
The contractor shall also maintain the records / registers as required by the local authorities / Govt. from time to time.
1 Measurement Books.
2 Cement Register (Daily Record).
3 Steel Register.
4 Steel Consumption Register – Bill wise.
5 Drawings register 6 Materials at site register.
7 Register for hindrance to work 8 Concrete cube Test Register.
9 File and Register for extra / variation items.
10 Materials test Register and File.
11 Site Order Book (in triplicate).
12 Lead caulking Register.
13 Labour Reports and progress Reports Register.
14 Site Visit & Instructions Register.
15 Certified true copies of the contracts 16 Register for running account bill & Register for secured advance 17 Register for labour
42.0 Force Majeure
42.1 Neither contractor nor PFRDA shall be considered in default in performance of their obligations if such performance is prevented or delayed by events such as war, hostilities revolution, riots, civil commotion, strikes, lockout, conflagrations, epidemics, accidents, fire, storms, floods, droughts, earthquakes or ordinances or any act of god or for any other cause beyond the reasonable control of the party affected or prevented or delayed. However, a notice is required to be given within 30 days from the happening of the event with complete details, to the other party to the contract, if it is not possible to serve a notice, within the shortest possible period without delay.
42.2 As soon as the cause of force majeure has been removed the party whose ability to perform its obligations has been affected, shall notify the other of such cessation and the actual delay incurred in such affected activity adducing necessary evidence in support thereof.
6442.3 From the date of occurrence of a case of force majeure obligations of the party affected shall be suspended during the continuance of any inability so caused. With the cause itself and inability resulting there from having been removed, the agreed time of completion of the respective obligations under this agreement shall stand extended by a period equal to the period of delay occasioned by such events.
43.4 Should one or both parties be prevented from fulfilling the contractual obligations by a state of force majeure lasting to a period of 6 months or more the two parties shall mutually decide regarding the future execution of this agreement.
44.0 Local Laws, Acts, Regulations:
The contractor shall strictly adhere to all prevailing labour laws inclusive of contract labour (regulation and abolition act of 1970) and other safety regulations. The contractor shall comply with the provision of all labour legislation including the latest requirements of all the Acts, laws, any other regulations that are applicable to the execution of the project.
i) Minimum wages Act 1948 (Amended) ii) Payment of wages Act 1936 (Amended) iii) Workmen’s compensation Act 1923 (Amended) iv) Contract labour regulation and abolition act 1970 and central rules 1971 (Amended) v) Apprentice act 1961 (amended) vi) Industrial employment (standing order) Act 1946 (Amended) vii) Personal injuries (Compensation insurance) act 1963 and any other modifications viii) Employees’ provident fund and miscellaneous provisions Act 1952 and amendment thereof ix) Shop and establishment act x) Any other act or enactment relating thereto and rules framed there under from time to time.
xi) Prevailing Indian Electricity rules & act.
45.0 Safety Code:
Safety Code as per annexure 4.32 should be followed
46.0 Accidents The contractor shall immediately on occurrence of any accident at or about the site or in connection with the execution of the work report such accident to the Architect/Consultant. The contractor shall also report immediately to the competent authority whenever such report is required to be lodged by the law and take appropriate actions thereof.
47.0 PFRDA BUILDING PROJECTS – MAINTENANCE OF RECORDS A. Registers at the site office 1 Measurement Books.
2 Cement Register (Daily Record).
3 Steel Register.
4 Steel Consumption Register – Bill wise.
5 Drawings register 656 Materials at site register.
7 Hindrance Register.
8 Concrete cube Test Register 9 File and Register for extra / variation items 10 Materials test Register and File 11 Site Order Book (in triplicate).
12 Lead caulking Register.
13 Labour Reports and progress Reports Register 14 Site Visit & Instructions Register 15 Certified true copies of the contracts II. SPECIAL CONDITIONS OF CONTRACT Scope of work
1.0 The scope of work is to Interior Works Consisting of Civil, Interior Furnishing Works, Electrical & Allied Works, HVAC Works, & Other Allied Services Works (FAS, PAS, ACS, Data Networking, CCTV), AV System, etc.
2.0 Address of site The site is located at 16th Floor, F-Wing, Maker Towers, Cuffe Parade, Mumbai - 400 005, Mumbai
(Maharashtra).
3.0 Dimensions and levels All dimensions and levels shown on the drawings shall be verified by the contractor at the site and he will be held responsible for the accuracy. Figured dimensions are in all cases to be accepted and dimension shall not be scaled. Large scale details shall take precedence over small scale drawings.
In case of discrepancy the contractor shall ask for clarification from the Architect / consultant before proceeding with the work.
4.0 Building Permissions/ Statutory Approvals The successful bidder/ contractor has to obtain necessary statutory approvals/ necessary permission from relevant Govt/ competent authority in consultation with Project Architect M/s Shetgiri & Associates for carrying-out the captioned project works time-to-time on behalf of the PFRDA. For 66the purpose, PFRDA will reimburse the statutory charges/ cost as actual, on production of tax receipts/ invoices in original by the bidder/ contractor.
In absence of necessary permissions/ statutory approvals in place, PFRDA will be at liberty to levy penalties on the successful bidder/ contractor or ask the successful bidder/ contractor to demolish the unauthorized works on his risk & cost.
5.0 Notice of operation The contractor shall not carry out any important operation without the Consent from the PFRDA Engineer/Architect / Consultant:
6.0 Construction records The contractor shall keep and provide to the Architect / consultant full and accurate records of the dimensions and positions of all new work and any other information necessary to prepare complete drawings recording details of the work as construction.
7.0 Safety of adjacent structures and trees The contractor shall provide and erect to the approval of the Architect / consultant supports as may be required to protect effectively all structures and protective give to trees, which may be endangered by the execution of the works or otherwise such permanent measures as may be required by the Architect to protect the tree structures.
8.0 Temporary works.
Before any temporary works are commenced the contractor shall submit at least in advance to the architect / consultant for approval complete drawings of all temporary works he may require for the execution of the works. The contractor shall carry out the modifications relating to strength, if required by the architect / consultant may require in accordance with the conditions of contract at his own cost The contractor shall be solely responsible for the stability and safety of all temporary works and unfinished works and for the Quality of the permanent works resulting from the arrangement eventually adopted for their execution.
9.0 Water power and other facilities a) The rate quoted by the contractor shall include all expenses that are required for providing all the water required for the work and the contractor shall make his own arrangements for the supply of good Quality water suitable for the construction and good Quality drinking water for their workers If necessary the contractor has to sink a tube well / open well and bring water by means of tankers at his own cost for the purpose PFRDA will not be liable to pay any charges in connection with the above.
b) The rate quoted in the tender shall include the expenses for obtaining and maintaining power connections and shall pay for the consumption charges c) The contractors for other trades directly appointed by the PFRDA shall be entitled to take power and water connections from the temporary water and power supply obtained by the contractor However, the concerned contractor shall make their own arrangements to draw the supply and pay directly the actual consumption charges at mutually agreed rates between them. All municipal charges for 67drainage and water connection for Construction purposes shall be borne by the contactor and charges payable for permanent connections, if any, shall be initially paid by the contactor and the PFRDA will reimburse the amount on production of receipts d) The PFRDA as well as the Architect / consultant shall give all possible assistance to the Contractor’s to obtain the requisite Permission from the various authorities, but the responsibility for obtaining the same in time shall be of the contractor
10.0 Facilities for contractor’s employees The contractor shall make his own arrangement for the housing and welfare of his staff and workmen including adequate drinking water facilities. The contractor shall also make the arrangements at his own cost for transport where necessary for his staff and workmen to and from site of work at his own cost.
11.0 Lighting of works The contractor shall at all times provide adequate and approved lighting as required for the proper execution and supervision and inspection of work.
12.0 Firefighting arrangements i) The contractor shall provide suitable arrangement for firefighting at his own cost. This purpose he shall provide requisite number of fire extinguishers and adequate number of buckets, some of which are to be always kept filled with sand and some with water these equipment’s shall be provided at suitable prominent and easily accessible place and shall be properly maintained.
ii) Any deficiency in the fire safety or unsafe conditions shall be corrected by the contractor at his own cost and, to the approval of the relevant authorities. The contractor make the following arrangements
at his own cost but not limited the following: a) Proper handling, storage and disposal of combustible materials and waste. b) Work operations which can create fire hazards. c) Access for fire-fighting equipment’s.
d) Type, number and location of containers for the removal of surplus materials and rubbish. e) Type, size, number and location of fire extinguishers or other tire fighting equipment. f) General house keeping
13.0 Site order book A site order book shall be maintained at site for the purpose of quick communication between the Architect / Consultant. Any communication relating to the work may be conveyed through records in the site order book. Such a communication from one party to the other shall be deemed to have been adequately served in terms of contract Each site order book shall have machine numbered pages in triplicate and shall carefully maintained and preserved by the contractor and shall be made available to the architect / consultant as and when demanded- Any instruction which the architect /consultant may like to issue to the contractor or the contractor may like to bring to the architect / consultant two copies of such instructions shall be taken from the site order book and one copy will be handed over to the party against proper acknowledgment and the second copy will be retained for their record.
6814.0 Temporary fencing/ barricading The contractor shall provide and maintain a suitable temporary fencing / barricading and gates at his cost to adequately enclose all boundaries of the site for the protection of the public and for the proper execution and security of the work and in accordance with the requirement of the architect / consultant and regulations of local authorities. These shall be altered, relocated and adopted from time to time as necessary and removed on completion of the work.
15.0 Site meetings Site meetings will be held to review the progress and Quality evaluation. There shall be a monthly Site meeting in presence of PFRDA as per instructions and directions received from time to time.
Apart from the monthly site meetings, weekly site meetings with the technical team of the project shall be held including progressive site meetings as and whenever required during the course of execution of works on site. The contractor shall depute a senior representative along with the site representative and other staff of approved sub-contractors and suppliers as required to the site meetings and ensure all follow up actions. Any additional review meetings shall he held if required by the architect/ consultant and the contractor along with his entire team shall remain present without fail.
16.0 Disposal of refuse The contractor shall cart away all debris, refuse etc. arising from the work from the site and deposit the same as directed by the architect / consultant at his own cost. It is the responsibility of the contractor to obtain from the local authorities concerned to the effect that all rubbish arising out of contractor’s activities at the construction site or any other off-site activities borrow pits has been properly disposed off.
17.0 Contractor to verify site measurement The contractor shall check and verify all site measurements whenever requested other specialists contractors or other sub-contractors to enable them to prepare the own shop drawing and pass on the information with sufficient promptness as will in any way delay the works.
18.0 Displaying the name of the work The contractor shall put up a name board of suitable size as directed by the architect/ consultant indicating therein the name of the project and other details as given by the architect/consultant at his own cost and remove the same on completion of work.
19.0 As built drawings i) For the drawings issued to the contractor by the Architect / Consultant. The architect Consultant will issue two sets of drawings to the Contractor for the items for some changes have been made. From the approved drawings as instructed by the PFRDA/ architect / consultant. The contractor will make the changes made on these copies and return these copies to the architect / Consultant for their approval. In cases revision is required or the corrections are not properly marked the architect / Consultant will point out the discrepancies to the contractor. The contractor will have to incorporated these corrections and / or attend to discrepancies either on copies as directed by the architect / consultant and resubmit to him for approval. The architect / consultant will return one copy duly approved by him.
69ii) For the drawings prepared by the contractor The contractor will modify the drawing prepared by him wherever the changes made by the PFRDA/ architect / consultant. And submit two copies of such modified drawings to the architect/ consultant for approval. The architect / consultant will return one copy of the approved drawing to the contractor.
20.0 Approved make The contractor shall provide all materials from the list of approved makes at his own cost and also appoint the specialized agency for the waterproofing anti-termite, aluminium doors and windows and any other item as specified in the tender. The architect/consultant may approve any make / agency within the approved list as given in the tender after inspection of the sample/mock up.
21.0 Procurement of materials The contractor shall make his own arrangements to procure all the required materials for the work.
All wastages and losses in weight shall be to the contractors account
22.0 Excise duty, taxes, levies etc.
The contractor shall pay and be responsible for payment of all taxes, duties, levies, royalties, fees, cess or charges except GST in respect of the works including but not limited to sales tax, tax on works contract excise duty, and octroi, except GST payable in respect of materials, equipment plant and other things required for the contact. All of the aforesaid taxes, duties, levies, fees and charges except GST shall be to the contractor’s account and the PFRDA shall not be required to pay any additional or extra amount on this account. Variation of taxes, duties, fees, levies etc if any except GST, till completion of work shall be deemed to be included in the quoted rates and no extra amount on this account. Variation of taxes, duties, fees, levies etc if any excluding GST, till completion of work shall be deemed to be included in the quoted rates and no extra claim on this account will in any case be entertained. If a new tax or duty or levy or cess or royalty or octroi is imposed under as statutory law during the currency of contract the same shall be borne by the contractor.
23.0 Acceptance of tender PFRDA shall have the right to reject any or all tenders without assigning any reason. They are not to bind to accept the lowest or any tender and the bidder or bidders shall have no right to question the acts of the PFRDA. However adequate transparency would be maintained by the PFRDA.
24.0 Photographs: • The Contractor shall at his own expense supply to the Architects with duplicate hard copies of large photographs not less than 25 cm. x 20 cm. (10” x 8”) of the works, taken from two approved portions of each building, at intervals of not more than one months during the progress of the work or at every important stage of construction.
• In addition to above, the contractor shall be bound to submit adequate no. of site photographs along with their each Running Bill for the project clearing showing major progress of work measured and claimed therein failing which the Architect/PFRDA may consider returning the Bill to the contractor and no claim for delay on this account will be entertained.
25.0 Corrupt Practices No representative of the PFRDA / Architect or any one directly or indirectly involved in this Works shall be offered by the Contractor or any of his Sub Contractor, directly or indirectly, any benefit, fee, commission, dividend, gift or consideration of any kind in connection with the services and will 70not at any time offer gratuities or merchandise cash services or other inducement. The Contractor is aware of and familiar with the existence, provisions and purposes of the Anti-Bribery laws described
below:
The prevention of corruption Act of 1998 (Indian Law) of the Indian penal code and the Foreign contribution (Regulation) Act of India (1976).
26.0 Liaisoning with the Statutory Authorities
26.1 The Contractor shall be responsible for taking the approvals / NOC’s from the statutory bodies like MCGM, Building Proposal, Ward Office of MCGM, Fire Departments, Ward Offices or any other Statutory approval authority and the official charges of these departments shall be reimbursed by the PFRDA on production of necessary documentary evidence in the form of challans & receipts. The successful contractor will indemnify the PFRDA / Architect for any problems arising out of such approvals. All the expenses involved for getting such approvals / NOC’s shall be paid by the contractor and no extra claim whatsoever shall be entertained. The Architect shall assist the contractor in coordination and making available the necessary drawings proposed by him for submission to the authorities, however the necessary follow-up & liaisoning with these departments shall be the responsibility of the contractor. Any damage arising out of strict action of any of these departments shall be the sole liability of the contractor.
27.0 SAFETY RULES & PRECAUTIONS WHILE WORKING
1. All personnel at site should be provided with Helmets and Safety Boots with some Identification Mark. Visitors also should be provided with Helmets. It should be ensured that these are used properly.
2. First Aid Box should be kept at site with all requisite materials
3. No one should be allowed to inspect / work at a height without Safety Belt.
4. Suitable scaffolds should be provided for workmen for all Works that cannot safely be done from the ground, or from solid construction except such short period Work as can be done safely from ladders. When a ladder is used an extra Mazdoor shall be engaged for holding the ladder and if the ladder is used for carrying materials as well as suitable footholds and handholds shall be
provided on the ladder and the ladder shall be given an inclination not steeper than ¼ to 1 (¼ horizontal and 1 vertical).
5. Scaffolding or staging more than 3.5 meters above the ground or floors, swung or suspended from an overhead support or erected with stationary support shall have a guard rail properly attached, bolted, braced and otherwise secured at least 1 Meter high above the floor or platform of such scaffolding or staging and extending along the entire length of the outside and ends thereof with only such openings as may be necessary for the delivery of materials. Such scaffolding or staging shall be so fastened as to prevent it from swaying from the building or structure.
6. Working platforms, Gangways, and Stairways should be so constructed that they do not sag unduly or unequally, and if the height of the platform or the Gangway or the Stairway is more than 3-5 Meters above ground level or floor level they should be closely boarded, should have adequate width and should be suitably fenced, as described.
7. Every opening in the floor of a building or in a working platform be provided with suitable means to prevent the fall of persons or materials by providing suitable fencing or railing whose minimum height shall be 1 Meter.
718. Safe means of access shall be provided to all working platforms and other working places. Every ladder shall be securely fixed. No portable single ladder shall be over 9 Meters in length while the width between side rails in rung ladder shall in no case be less than 30cms for ladder up to and including Meters in length. For longer ladders this width should be increased at least 6mm for each additional 30 cms. Uniform step spacing shall not exceed 30 cms.
9. Adequate precautions shall be taken to prevent danger from electrical equipments. For electrical on line works gloves, rubber mats, and rubber shoes shall be used.
10. All trenches 1.2 Meters or more in depth shall at all times be supplied with at least one ladder for each 30 Meters length or fraction thereof. Ladder shall be extended from bottom of the trench to at least 1 Meter above the surface of the ground. The sides of the trenches, which are 1.5 Meters or more in depth shall be stepped back to give suitable slope, or securely held by timber bracing, so as to avoid the danger of sides collapsing. The excavated materials shall not be placed within
1.5 Meters of the edge of the trench or half of the depth of the trench whichever is more cuttings shall be done from top to bottom. Under no circumstances undermining or under cutting shall be done.
11. Before any demolition work is commenced and also during the process of the work :- a) All roads and open areas adjacent to the Work Site shall either be closed or suitably protected. b) No electrical cable or apparatus which is liable to be a source of danger over a cable or apparatus used by the operator shall remain electrically charged.
c) All practical steps shall be taken to prevent danger to persons employed from risk or fire or explosion or flooding. No floor, roof or other part of the building shall be so over-loaded with debris or materials as to render it unsafe.
d) All necessary personal safety equipment as considered adequate by the Site Engineer should be kept available for the use of the persons employed on the Site and maintained in a condition suitable for immediate use; and the Contractor should take adequate steps to ensure proper use of equipment by those concerned.
e) Workers employed on mixing Asphaltic materials, cement and lime mortars shall be
provided with protective footwear and protective goggles. f) Those engaged in white washing and mixing or stacking of cement bags or any materials which is injurious to the eyes shall be provided with protective goggles.
g) Those engaged in welding works shall be provided with Welder’s protective eye-shields. h) Stone breakers shall be provided with protective goggles and protective clothing and seated at sufficiently safe intervals.
i) When workers are employed in sewers and manholes, which are in use, the Contractor shall ensure that the manhole covers are opened and are ventilated at least for an hour before the workers are allowed to get into the manholes and the manholes so opened shall be cordoned off with suitable railing and provided with warning signals and boards to prevent accident to the Public.
7212. Use of hoisting machines and tackle including their attachments, anchorage and support shall
conform to the following standard or conditions: - a) These shall be of good mechanical construction, sound material and adequate strength and free from patent defect and shall be kept in good repairs and in good working order.
b) Every rope used in hoisting or lowering materials or as a means of suspension shall be of durable quality and adequate strength, and free from patent defects. c) Every crane driver or hoisting appliance operator shall be properly qualified and no person under the age of 21 years should be in-charge of any hoisting machine including any scaffold, winch or give signals to the operator.
d) In case of every hoisting machine and of every chain ring hook, shackle swivel and pulley block used in hoisting or lowering or as means of suspension the safe working load shall be ascertained by adequate means.
e) Every hoisting machine and all gear referred to above shall be plainly marked with the safe working load. In case of hoisting machine having a variable safe working load, each safe working load of the conditions under which it is applicable shall be clearly indicated. No part of any machine or of any gear referred to above in this paragraph shall be loaded beyond the safe working load except for the purpose of testing.
f) Motor, Gearing, Transmission, Electric wiring and other dangerous parts of hoisting appliances should be provided with efficient safeguards, hoisting appliances should be provided with such means as will reduce to the minimum the risk of accidental descent of the load, adequate precautions should be taken to reduce to the minimum the risk of any part of a suspended load becoming accidentally displaced.
g) When workers are employed on electrical installation, which are already energized, insulating mats, wearing apparel such as gloves, sleeves, and boots as may be necessary should be provided.
The workers should not wear any rings, watches and carry keys or other materials, which are good conductors of electricity.
13. All scaffolds, ladders and other safety devices, mentioned or described herein shall be maintained in safe condition and no scaffold, ladder or equipment shall be altered or removed while it is in use.
Adequate washing facilities shall be provided at or near places of work.
1. Observance of Contract Labour Act 1970 Various provisions of the Contract labour Act 1970 and the rules made there under cast certain obligations on the PFRDA in respect of PFRDA Projects under construction at various centers. Under the Act, the CGM of Department would be considered as the “Principal Employer”, even though the labourers are employed by the building contractor. The Act applies to every establishment in which twenty or more workmen are employed or were employed on any day of the preceding 12 months as contract labour. A workman shall be deemed to be employed as contract labour in connection with the work of an establishment when she/he is hired in connection with such work through a contractor with or without the knowledge of the principal employer.
73However, in the cases of package deal agreements, it would not apply until the builder/vendor is deemed to be a contractor after execution of Deed of Conveyance, if so provided in the agreement.
The Act also does not apply to the work of gardening, maintenance of residential colonies and services therein. Such arrangements need not be included in the records to be maintained under the Act and rules made thereunder. During the construction of a project the “Principal Employer” shall comply with certain provisions of the Act in so far as they are applicable to the particular case. These provisions relate to-
(i) Registration of Establishment (Section 7).
The principal employer shall make an application to the registering officer in the prescribed manner for registration of establishment. The application for registration shall be made in triplicate in Form No.1 (Ref. Annexure 4.11) to the registering officer of the area in which the establishment sought to be registered is located. The application shall be accompanied by the Treasury receipt showing payment of fees for the registration of the establishment. The application shall be either personally delivered to the registering officer or sent to him by registered post. The employer can not employ the contract labour in his establishment unless he registers under Section 7 of the Act.
(ii) Maintenance of registers and other records (Section 29).
The following registers and records are required to be maintained by the Principal Employer: a) Register of contractors in Form XII of the Contract Labour (Regulation & Abolition) Control Rules 1971 (Refer Annexure-4.12).
b) Notice showing the rates of wages, hours of work, wage period, dates of payment of wages, names and address of the Inspectors having jurisdiction and date of payment of unpaid wages, shall be displayed in English and in Hindi and in local language, in conspicuous places at the work site.
c) Return intimating the actual date of the commencement or completion of each contract work, under each contractor, shall be submitted to the Inspector within 15 days from the commencement or completion of the work as the case may be. The return shall be filed in Form No.VI B (Refer Annexure 4.13).
d) The annual return in duplicate in Form No. XXV (Annexure 4.14) shall be submitted to the Registering Officer concerned so as to reach him not later than the 15th February following the end of the year to which it relates.
All the registers, records and notices shall be produced on demand before the Inspector or any other authority under the Act.
(iii) Responsibility of payment of wages of workmen (Section 21).
Every principal employer shall nominate a representative duly authorized by him to be present at the time of disbursement of wages by the contractor and it shall be the duty of such representative to certify the amounts paid as wages in the prescribed manner. The authorized representative shall record under his signature, a certificate at the end of the entries in the Register of wages or in the Register of wage and Muster Roll, in the following form.
"Certified that the amount shown in Column No. ____ has been paid to the workmen concerned in my presence on ________ at __________________." The Contractor shall be advised to disburse the wages in the presence of the authorized representative. If the contractor fails to make payment of wages within the prescribed period or makes short payment, the principal employer shall be liable to make payment of wages in full or the unpaid balance due to the contract labour employed by the contractor and recover the amount so paid from amounts payable to the contractors.
(iv) Welfare measures (Sections 16 to 19) The welfare measures like canteen, rest rooms and other facilities to the contract labour are required to be provided by the contractor himself, but if any of the facilities is not provided by the contractor, then it shall be provided by the employer within 7 days of the commencement of the employment of 74contract labour. However, all expenses incurred by the PFRDA in providing the amenity shall be recovered from the Contractor either by deductions from any amount payable to the contractor or as a debt payable by the contractor.
(v) Penalty for contravention (Section 22 to 27). a) Whoever obstructs an Inspector in the discharge of his duties under the Act or refuses or will fully neglects to afford the Inspector any reasonable facility for making any inspection, examination, enquiry or investigation authorised by or under the Act in relation to an establishment, shall be punishable with imprisonment for a term which may extend to 3 months or with fine which may extend to Rs.500/- or with both.
b) The contravention of any provision of the Act or of the rules made thereunder or contravention of any condition of a license granted under the Act is punishable with imprisonment which may extend to 3 months or with fine which may extend up to Rs.1000/- or with both.
The contractor shall ensure that all the obligations under the relevant provisions of the Act including obtaining licenses under Section 12 of the Act are complied with. Before releasing the contractor’s final payment, it shall be ensured that the contractors have paid all dues to their contract labour.
INDEX III. PROFORMAS OF VARIOUS TESTS TABLE NO. DESCRIPTION
1. Record of Cement/Received/Used/Balance.
Proforma of Paint/Lead/CICO Register.
2.
Record for Reinforcement Bars Received.
3.
Proforma for Register of Material of Site Account.
4.
Proforma for Account of Secured Advance Register.
5.
Proforma for Bulkage Test of Sand Register.
6.
Proforma for Silt Test Register.
7.
Proforma for Sieve Analysis of Fine Aggregate Register.
8.
Proforma for Sieve Analysis of Coarse Aggregate Register.
9.
Proforma for Slump Test Register.
10.
Proforma of Cube Test Register.
11.
Proforma for Hindrance to Work.
12.
13. Proforma for Running A/c. Bill.
7514. Account of Secured Advance if Admissible on Materials Held at Site by the Contractors
15. Memorandum for Payment.
76TABLE-I RECORD OF CEMENT RECEIVED / USED / BALANCE S. No. Cement in Cement received Total Source Description Number oBfa lance Signature of stock Bags (Bags) Cement from of work cement in Contractors received which Where bags stock PFRDA /
(Bags) received cement is consumed Engineer used 1 2 3 4 5 6 7 8 9 77TABLE-II RECORD OF PAINT / LEAD / CICO REGISTER
Name of work :
Name of the Contractor :
Agreement No. :
Date of Source Qty. Prog Item of work Date Qua Qty. Total Delay Contractors Site Signature Receipt Receipt Rec ressi for which of ntity return issued Balance initials Engineers of PFRDA/ with eive ve issued with issues issue ed at at hand initials Architect Ref. To d Total approx. qty. d the S.O./In work done in end of dent case of paint the only day 1 2 3 4 5 6 7 8 9 10 11 12 13 Register for bitumen should be maintained. The format will be similar to that for cement.
78TABLE-III RECORD OF REINFORCEMENT BARS RECEIVED Truck Challan Name of Binding Wire 6mm dia. 8mm dia. 12mm 16mm 20mm 25mm Total No. No. Supplier dia. dia. dia. dia. Received 1 2 3 4 5 6 7 8 9 10 11 Number of diameters given is only illustrative. Open more columns for other diameters wherever needed.
79TABLE-IV PROFORMA FOR REGISTER OF MATERIAL AT SITE ACCOUNT
Name of Work : Name of Article :
Name of Contractor : Estimated Requirement :
Agreement No. : Issue Rate :
Date of Received from/Issued to Receipt Issue Balance Initials oInf itial of PFRDA/ Remark Receipt (with Ret. to So/Indent) Contractor Architect's representative 1 2 3 4 5 6 7 8 80TABLE-V PROFORMA FOR ACCOUNT OF SECURED ADVANCE REGISTER.
Name of Work :
Name of Contractor :
Agreement No. :
Descripti Qty. Deduct Qty. Qty.outstanding & Signature of Signature oInf itial of Remark on of outstanding utilised in Qty.brought to site Site Engineer Contractor PFRDA/ Material from previous works measured since previous bill Architect's Bill since previous bill representative 1 2 3 4 5 6 7 8 81TABLE-VI PROFORMA FOR BULKAGE TEST OF SAND REGISTER Sr. .No. Date of Volume of dust sand in Volume inundated Percentage of Signature of Signature of Initial of PFRDA Architect's Test Cylinder inundated & Sand in Cylinder Bulkage Site Engineer Contractor representative (Periodical) stirred 1 2 3 4 5 6 7 8 82TABLE-VII PROFORMA OF SILT TEST REGISTER S Date Height of Sand in Height oMf ax percentage Percentage of Signature Signature Initial of PFRDA / r. of Cylinder inundated& Silt of silt as specified silt obtained of Site of Representative N Test stirred Engineer Contractor (Periodical) o .
1 2 3 4 5 6 7 8 9 83TABLE-VIII PROFORMA SIEVE ANALYSIS OF FINE AGGREGATE REGISTER Sr. Date Wt. of Sieve Wt. of %a retained in Cumulative % F.M. Signature Signature Signature of PFRDAs/ No of Materia as per Sand each sieve retained in of Site of Architect's representative Test l to be I.S. retained in successively each sieve Engineer Contractor & Remarks (Periodical) tested designa sieve tion 84TABLE-IX PROFORMA OF SIEVE ANALYSIS OF COARSE AGGREGATE REGISTER S. Date of Wt. of Nominal I.S. Standard Test Obtained Signature Signature of Signature of No. Testing Material size of Sievede passing for Result passing of Site Contractor PFRDAs/ Architect's to be Aggregat signatio graded Engineer representative & tested e n aggregate. of Remarks nominal size (Periodical) 1 2 3 4 5 6 7 8 9 10 11 85TABLE-X PROFORMA FOR SLUMP TEST REGISTER Sr. Date of Type of Specified slump Slump Obtained Signature of Signature of Signature of PFRDA/ No. Testing work for When When Vibrators When When Vibrators Site Engineer Contractor Architect's which Vibrator are not used Vibrators are are not used representative & slump taken s are used Remarks (Periodical) used 1 2 3 4 5 6 7 8 9 10 86TABLE-XI PROFORMA OF CUBE TEST REGISTER Date oSfa mpleN o. SpecificP roportiDoescriptSiignatureS igna 7/28 Days Testing Permissible CompressivRee marks on Remarks taking No. of markingn oofn ooff ture of strength of Concrete / Test Report of Cube + Cubeso f Cubesm ixture work Engineer Contra 28 Days / 7 days and No. PFRDA/ Lime taken carried taking ctor Architects out sample representa tive Date Test Av. Stran-dard 7 Days 28 Days Periodical of Result Stren-gth stren-gth s Test Kg/ Kg. / Kg / Sq.cm.
Sq.cm Sq.cm.
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 87TABLE-XII PROFORMA FOR HINDRANCE TO WORK
Name of Work : Date of Start of work :
Name of Contractor : Period of Completion :
Agreement No. : Dt. of Completion of work :
S.No. Nature oDf ate of Date of Period of Signature of Signature of PFRDA / Hindrance Occurrence owf hich Hindrance which Site Engineer Architects Representative Hindrance was removed Hindrance existed 1 2 3 4 5 6 7 88PROFORMA FOR RUNNING A/C BILL i. Name of Contractor / Agency :
ii. Name of Work : iii. Sl.No. of this Bill : iv. No. & Date of previous Bill : v. Reference to Agreement No. : vi. Date of Written order to commence : vii. Date of Completion as per Agreement :
S.No. Item Description Unit Rate (₹) As per Tender Quantity Amount (₹) 1 2 3 4 5 Upto Previous R.A. Bill Up Date (Gross Present Bill Remarks Quantity Amount (₹) Quantity Amount (₹) Quantity Amount (₹) 6 7 8 9
Note: 1. If part rate is allowed forany items, it should b e ____________ indicated with reasons for allowing such a rate. ___________ Net Value since previous bill
2. If ad-hoc payment is made, it should b e mentioned specifically.
Page 89 of 171 89CERTIFICATE The measurements on the basis of which the above entries for the Running Bill No. -------------------------- were made have been taken jointly on -------------------------- and are recorded at pages -------------------------- to ---- ---------------------- of measurement book No. --------------------------.
-------------------- ----------------------- --------------------- Signature and Signature and Signature and date of Contractor date of Architects date of Site Engineer Representative(Seal) The work recorded in the above-mentioned measurements has been done at the site satisfactorily as per tender drawings, conditions and specifications.
-------------------- --------------------- Architect Signature and date of Site Engineer Page 90 of 171 90TABLE - XIV ACCOUNT OF SECURED ADVANCE, IF ADMISSIBLE ON MATERIALS HELD AT SITE BY THE CONTRACTOR S.No. Item Quantity Unit Amount Remarks 1 2 3 4 5 6 Total value of materials at Site.
Secured Advance @ ---------------- of above value - B
CERTIFIED:
(i) That the materials mentioned above have actually been brought by the Contractor to the site of the work and on advance on any quantity of any of this item is outstanding on their security.
(ii) That the materials (are of imperishable nature) and are all required by the Contractor for use in the work in connection with the items for which rates of finished work have been agreed upon.
Dated Signature of Site Engineer Preparing the bill Rank ----------------------------- Date signature of PFRDAs Architects------------------- (Name of the Architects) --------------------------- Dated Signature of the Contractor Page 91 of 171 91TABLE - XV MEMORANDUM FOR PAYMENT R/A BILL NO.
1. Total value of work done since previous ₹ ----------- bill (A)
2. Total amount of secured advance due ₹ ----------- since Previous Bill (B)
3. Total amount due since Previous Bill (C) ₹ ----------- (A+B)
4. PVA on account of declaration in price of ₹ ----------- Steel, Cement and other materials and labour as detailed in separate statements enclosed.
5. Total amount due to the Contractor ₹ -----------
OBJECTIONS: i) Secured Advance paid in the previous ₹ ----------- R/A ii) Retention money on value of works as ₹ ----------- per accepted tenders upto date amount ₹ Less already recovered ₹ ----------- Balance to be recovered ₹ ----------- iii) Mobilization Advance, if any
(a) Outstanding amount (principal + interest) ₹ ----------- as on date
(b) To be recovered in this bill ₹ ----------- iii. Any other Departmental materials cost to ₹ ----------- be recovered as per contract, if any Page 92 of 171 92iv. Any other Departmental service charges ₹ ----------- to be recovered if any, as per contract (water, power etc.) enclose statement.
Total Deduction as per contract (F) ₹ ----------- Adjustments, if any ------------------- ₹ ----------- Amount less received by Contractor in -- ------- R/A Bill (as per statement of Contractor) P.V.A. ₹ ----------- Total amount payable as per contract ₹ ----------- (E+F+G) (Rupees --------------------------- in words) The bill amount to ₹ ----------------- (both figures and words) has been scrutinized by us after due checking of the measurements of work as required and is recommended for payment.
Date: ------------------------- ----------------------------- Signature of Architect with Seal The bill amount to ₹ ----------------- certified by Consultants has been scrutinized by me after due test checking of measurements of works as required and is recommended for payment for an amount of ₹..................................
Date : ----------------------------- Signature of Owners Engineer
STATUTORY DEDUCTION: i) Total Amount due (E) ₹ ----------- ii) Less I.T. Payable ₹ ----------- iii) Less S.T. Payable ₹ ----------- Net Payable ₹ ----------- These figures given in the Memorandum for payable has been verified and bill passed for payment ------------------ ---------------------------------------------- (in words and figures) Page 93 of 171 93Date: ---------------------- ---------------------------------- Assistant General Manager(Premises& Estate) MODE OF MEASUREMENT
1. Unless otherwise stated, all pipes shall be measured net, length as laid and measured overall fittings, such as bends, junctions, etc., and given in running meters. The length shall be taken along the centre line of the pipes and fittings.
2. Length of fittings viz, taps, valves, traps etc., which are paid under appropriate items shall not be re- measured under linear measurements as enumerated above.
3. Soil waste and vent pipes shall be measured along the centre line of the stack including the connecting bends/tees to W.C. Pan, Nahani trap, etc. and shall be paid as enumerated above.
4. W.C. Pans, Lavatory basins, Sinks, drain boards, Urinals, Mirrors, Glass shelf Toilet paper Holder, shall be measured by number and shall include all accessories as enumerated in detail specification under each item.
5. Unless otherwise specified, all types of taps, valves, etc., shall be measured by number and paid separately.
6. Manholes, inspection Chambers, Gully traps, etc. shall be constructed according to detail specification and measured by number and paid separately. The depth of Manhole shall mean the vertical distance from the top of the Manhole cover to the outgoing invert of the main drain channel.
7. Water meter shall include Y strainer and other appurtenances required by the local bodies and shall include brick masonry chamber, etc., as per detailed specifications and item shall be measured by number and paid for accordingly or as per Bill of Quantity.
Page 94 of 171 94IV. TECHNICAL SPECIFICATION (CIVIL & ALLIED SERVICES)
SECTION – A: MATERIALS
1) Material shall be of best approved quality obtaining and they shall comply with the respective Indian Standard Specification.
2) Samples of all materials shall be got approved before placing order and the approved sample shall be deposited with the Architect.
3) In case of non-availability of materials in metric sizes the nearest size in FPS units shall be provided with prior approval of the Architects for which neither extra will be paid nor shall any rebates be recovered.
4) If directed, materials shall be tested in any approved Testing Laboratory and the test certificates in original shall be testing including charges for repeated tests, if ordered, shall be borne by the Contractor.
5) It shall be obligatory for the Contractor to furnish certificate, if deemed by the Architects, from manufacturer or the material supplier that the work has been carried out by using their material and as per their recommendations.
6) All materials supplied by the Employer / any other Specialist Firms shall be properly stored and the Contractor shall be responsible for its safe custody until they are required on the works and till the completion of the work.
7) Unless otherwise shown on the Drawings or mentioned in the “Bill of Quantities” or special specification, the quality of materials, workmanship, dimensions, etc., shall be as specified as hereunder.
8) All equipment and facilities for carrying out field tests on materials shall be provided by the Contractor without any extra cost. a) Cement:
Cement shall comply in every respect with the requirements of the latest publications of IS: 269 and unless otherwise specified ordinary Portland Cement shall be used.
The weight of ordinary Portland Cement shall be taken as 1440 kg. per cu.m. (90 lbs. per c.ft.). Cement shall be measured by weight and in whole bags, and each undisturbed and sealed 50 kg. bag being considered equivalent to 35 liters (1.2 c.ft.) in volume care should be taken to see that each bag contains full quantity of cement. When part bag is required cement shall be taken by weight or measured in measuring boxes.
No other make of cement but that approved by the Architects will be allowed on works and the source of supply will not be changed without approval of Architect in writing. Test certificates to show that cement is fully complying the specifications shall be submitted to the Architects and notwithstanding this, the Architect may at his discretion, order that the cement brought on site and which he may consider damaged or of doubtful quality for any reason whatsoever, shall be re-tested in an approved testing laboratory and fresh certificates of its soundness shall be produced.
Cement ordered for re-testing shall not be used for any work pending results of re-test.
Page 95 of 171 95Cement shall be stored in weather-proof shed with raised wooden plank flooring to prevent deterioration by dampness or intrusion of foreign matter. It shall be stored in such a way as to allow the removal and use of cement in chronological order of receipt i.e., first received being used first used. Cement deteriorated and or clotted shall not be used on the work but shall be removed at once from the site. However, allowing use of warehouse set cement shall be determined by the Architects.
b) Lime:
Lime shall comply in every respect with the requirements of IS: 712 and shall be made from approved line stone or kankar and properly burnt. It shall be free from excess of unburnt kankars or lime stone ashes or other extraneous materials and shall be stored in weather-proof sheds. Lime which has damaged by rain, moisture, or air slacking shall not be used but shall be removed from the site of work forthwith. Lime shall be slacked with fresh water and screened through appropriate screens and stored and used within 14 days provided it is protected from drying out.
Field tests according to IS: 1624 shall be carried out from time to time to determine the quality of lime. c) River Sand:
River sand shall confirm to IS: 383 and relevant portion of IS: 515. It shall pass through pass through a I.S. sieve 4.75 mm. (3/16 B.S.) test sieve, leaving a residue not more than 5%. It shall be from natural source i.e.
only river or crushed stone screenings, if allowed, chemically clean, sharp, hard durable, well graded and free from dust, pebbles, clay, shale, salt, organic matter, loam, mica or other deleterious matter. The sum percentages of all deleterious substances to acceptable limits. River sand shall not contain any trace of salt and it shall be tested and river sand containing any trace of salt shall be rejected.
The fine aggregate i.e. river sand for concrete shall be graded within limits as specified in IS: 383 and the fineness Modules may range between 2.60 to 3.20.
The fine aggregate shall be stacked carefully on a clean hard dry surface so that it will not get mixed up with deleterious foreign materials. If such a surface is not available a platform of planks or corrugated iron sheets or brick floor or a thin layer of lean concrete shall be prepared.
d) Fine & Coarse Aggregate:
Shall consist of crushed or broken stone 95% of which shall be retained on 4.75 mm. IS tests sieve. It shall be obtained on crushing Granite, Quartzite, Trap, Basalt, or similar approved stones from approved quarry and
shall confirm to IS:383 and IS 515. Fine & Coarse aggregate shall be chemically inert when mixed with cement and shall be cubical in shape and be free soft, friable, thin, porous, laminated or flaky pieces. It shall be free from dust and any other foreign matter.
Gravel / Shingle of desired grading may be permitted as a substitute in part or full in plain cement concrete if the Architect is otherwise satisfied about the quality of aggregate. For all the R.C.C. works the size of coarse aggregate shall be 20 to 25 mm. and fine aggregate shall be 10 to 15 mm.
Page 96 of 171 96e) Reinforcement:
Reinforcement shall be of mild steel tested quality confirming to I.S.: 432-1966 and any other I.S. applicable
or deformed bar confirming to IS:1786 and Is:1139 or hard drawn Fe 415 (Tor Steel) steel wire fabric
confirming to IS:1566;1967.
All finished bars shall be free from cracks, surface flaws, laminations, jagged and imperfect edges. f) Bricks :
Bricks shall generally comply with IS:1077 except in size which shall be classified as 1st and 2nd class.1st class bricks shall be the best quality locally available table moulded, well burnt but not over burnt, have plain rectangular faces with parallel sides and sharp right-angled edges, have a find compact and uniform texture.
The bricks shall be free from cracks, chips, flaws, stones or subsequent to soaking in water. It shall emit a clear ringing sound on being struck and shall not absorb water more than 20% by weight. Common building bricks shall have a compressive strength of 35 kg. / sqm unless otherwise specified for first class bricks.
g) Neeru:
Shall be made of Class “C” Lime (i.e. pre-fat lime) as mentioned in IS: 712. It shall be slaked with fresh water then sifted and reduced to a thick paste by grinding in a mill. Neeru thus prepared shall be kept moist until used and no more than that can be consumed in 15 days shall be prepared at time.
h) Surkhi :
Shall be made by grinding well burnt bricks, brick bats, burnt clay balls, etc., the brick etc., to be used shall be prepared from selected clay. The quality shall confirm to IS:1344.
Bricks bats, etc., shall be ground in mechanical disintegrator to a find powder passing through IS Sieve No. 9 (2.36 mm.) with a residue not exceeding 10% by weight.
Surkhi for lime surkhi plaster shall be ground to fine powder in a mortar mill to pass through IS Sieve 150 micron (No. 100) Surkhi shall be stored in a weather-proof shed on a brick pave platform. i) Water :
Water for mixing cement / lime / surkhi mortar or concrete shall not be salty or brackish and shall be clean, reasonably clear and free from objectionable quantities of silt and traces of oil, acid and injurious alkali, salts, organic matter and other deleterious materials which will either weaken the mortar or concrete or cause affluence or attack the steel in reinforced cement concrete. Water shall be obtained from sources approved by the Architect. Potable water is generally considered satisfactory for mixing and curing concrete, mortar masonry, etc., where water other than main source is used this shall be tested in an approved testing laboratory to establish its suitability. All charges connected therewith shall be borne by the Contractor.
j) Timber :
Page 97 of 171 97Timber shall be well seasoned and of the best quality Indian Teak of specified species viz., Dandeli, Balarshah, Melabar, C.P.
Timber shall be considered as well seasoned, if its moistures content does not exceed the following limits. a) Timber for frames 14% b) Timber for planking, shutters, etc. 12% The moisture content of timber shall be determined according to method described in paragraphs 4 of IS:287 for Maximum permissible moisture content of timber used for different purpose in different climatic zones.
In measuring cross-sectional dimensions of the frame pieces tolerance up to 1.5 mm. shall be allowed for each planed surface. k) Superior quality Indian Teak Wood :
Superior quality Indian Teakwood means Dandeli, Balarshah, and Malabar Teak. It shall be of good quality and well-seasoned. It shall have uniform colour, reasonably straight grains, and shall be free from large. Loose, dead knots, cracks, shakes, warp, twists, bends, borer holes, sap-wood or defects of any kind. No individual hard and should knot shall be more than 1 cm. in diameter and aggregate areas of all knots shall not exceed ½% of area of the piece. There shall not be less than 6 growth rings per 2.5 cm. width.
l) 1st Class Indian Teakwood :
1st Class Indian Teakwood means C.P. and Bulsar teak of good quality and well-seasoned. It shall have uniform colour, reasonably straight grains and shall be free from large. Loose dead knots, cracks, shakes, warp, twists, bends, sap-wood or defects of any kind. No individual hard and should knot shall be more than 2.5 cm. in diameter and aggregate areas of all the knots exceed 1% areas of the piece. There shall not be less than 5 growth tings per 2.5 cm. width.
m) 2nd Class Indian Teakwood :
Shall be similar to first class Indian teak wood except that knot up to 4 cm. diameter and aggregate area of all knots up to 1 ½% of the area of the piece shall be allowed. There shall not be sapwood up to 15% is allowed.
n) Flush Doors :
All flush doors shall be solid core exterior grade unless otherwise specified and it shall generally confirm to IS:2202 and shall be fabricated as described under specification. o) Steel Windows and Doors :
Steel windows and doors shall be fabricated of steel sections conforming to IS:226. They shall conform to IS
1038. Unless otherwise specified the details of construction etc., shall be as described under specification.
Page 98 of 171 98p) Interlocking Pavers :
Designer pre-cast concrete interlocking paver block, shall conform to IS:1237. Tiles shall be compacted by mechanical vibration and hydraulically pressed. The size and thickness of tiles shall be as approved by the Architect.
q) Vitrified Tiles :
Vitrified tiles shall comply with IS:777 or relevant or latest I.S. code. It shall be from an approved manufacturer and shall be flat and true to shape. They shall be free cracks, crazing, spots, chipped edges and corners. The glazing and colour shall be uniform shade and unless otherwise specified the tiles shall be 9 mm. thick.
r) Marbles :
Marble slabs for flooring, dado veneering etc., shall be of kind specified in the item such as white or pink, Makrana, Chittor black, Bhanslana black, Jaisalmer yellow, Baroda green, Patiala (Pepsu) grey, etc., Marble from which slabs are made shall be selected quality, hard, sound dense and homogenous in texture and free from cracks, weathering, decay and flaws. Before starting the work, the contractor shall get the sample of Marble slabs approved by the Architect.
The slabs shall be machine cut and machine polished. s) Kotah / Shahabad / Cudappa / Granite :
Shall be of selected quality, hard, sound, dense, and of homogenous texture, free from cracks decay, weathering and flaws. Stone slabs shall be of uniform colour as approved by the Architect. They shall be machine cut and machine polished where specified and shall confirm to the required size. Thickness shall be specified in the respective items.
t) Glazing :
Glass used for glazing shall be float glass of best quality, free from flaws, specks bubbles and shall be 2.9 mm. thick up to 0.60 x 0.60 mm. size and for larger size it shall be 4 mm. thick unless otherwise specified in the Bill of Quantities.
The following type of glasses shall be used:-
1) For Office Building Clear glass or as specified in the Bill of Quantities.
2) Office (toilets) Clear or frosted
3) Partitions Frosted Page 99 of 171 99u) Asbestos Roofing & rain Water Pipes :
All Asbestos pipes and fittings shall comply with IS:459 and shall be free from cracks, chipped edges of corners and other damages. v) MPI. Sheets :
MPI. Sheets shall be of a gauge specified in the description of the item and shall conform to the IS:277. The sheets shall be free from cracks, spilt edges, twists, surface flaws, etc. They shall be clean bright and smooth.
Galvanising shall be uninjured and the perfect condition. The sheet shall show no sign of rust or white powdery deposits on the surface. The corrugations shall be uniform in depth and pitch and parallel.
w) Paints :
Lime for lime wash, dry distemper, oil bound distemper cement primer, oil paint, enamel paint, flat oil paint, plastic emulsion paint, anti-corrosive primer, red lead, water-proof cement paint and exterior grade Acrylic Emulsion paint, cement paint, sand-tex matt shall be from an approved manufacturer and shall conform to the latest Indian Standard for various paints. Ready mixed pains as received from the manufacturer without any admixture shall be used, except for addition of thinner, if recommended by the manufacturer.
x) Mortar :
Lime SurkhiMortar :
Lime and surkhi shall confirm to the specifications. It shall be composed of approved lime and surkhi in proportion of 1 lime to 2 surkhi mixed thoroughly. The ingredients shall be accurately gauged by measure and shall be well and evenly mixed together on a platform and water added to make it homogenous. When large quantities are required the mortar shall be mixed in a mechanical grinder.
Cement Mortar :
Cement mortar shall be of proportions specified for each type of work in the schedule. It shall be composed of Portland Cement and sand. The ingredients shall be accurately gauged by measure and shall well and evenly mixed together in a mechanical pan mixer, care being taken not to add more water than is required. No mortar that has begun to set shall be used. River sand shall be used unless otherwise specified.
If hand mixing is allowed, then it shall be done on pucca water-proof platform. The gauged materials shall be put on the platform and mixed dry. Water will then be added and the whole mixed again until it is homogenous and of uniform colour. Not more than one bag of cement shall be mixed at one time and which can be consumed within half an hour of its mixing.
Composite Lime, Cement, Sand Mortar :
The mortar shall be of proportions specified for each type of work in the Bill of Quantities. It shall comprise of Portland cement, lime and sand. Lime shall be measured in gauge boxes similar to one used for measuring cement and sand to the proportion specified and sufficient water then added to it to form a thick slurry thus Page 100 of 171 100obtained shall then be added to dry cement and sand mixture and thoroughly mixed to make a workable homogenous mortar of uniform colour by adding more water if necessary. Mechanical mixers shall generally be used for mixing such mortars. If hand mixing is allowed it shall be done on pucca platform.
Note :
In connections with the I.S. Code numbers indicated under Section, Specification, Section A – General Refer to the following I.S. Code numbers and the year and or otherwise latest modified I.S. Code Number.
1) Cement : I.S. 269 – 1976
2) Lime : I.S. 712 – 1964 I.S. 1624 – 1960
3) Fine – Aggregate : I.S. 383 – 1970
4) Coarse – Aggregate : I.S. 515 – 1970
5) Reinforcement : I.S. 432 – 1966 Fe 415 I.S. 1786 – 1966 (Tor Steel) I.S. 1139 – 1966
6) Bricks : I.S. 1077 – 1970
7) Neeru : I.S. 712 – 1964
8) Surkhi : I.S. 1344 – 1968
9) Timber : I.S. 287 – 1960
10)Flush Doors : I.S. 2202 – 1966
11)Floor Tiles : I.S. 1237 – 1980
12)Ceramic / Vitrified Tiles : I.S. 777 – 1970
13) Asbestos Roofing
and Rainwater pipes : I.S. 459 – 1962
14) R.C.C. design mix M-25 : I.S. 456 – 2000
SECTION – B: MODE OF MEASUREMENTS
The method of measurement for various items in the tender shall be generally in accordance with the IS: 1200 subject to the items for which the mode of measurements is not given under or elsewhere in the tender.
1) Excavation : a) Footings: Area of excavation for footing shall be measured equal to the area of the lowest concrete as shown on the drawing. Depth shall be measured vertically from ground level to bottom of concrete course or dry rubble packing as the case may be.
b) Plinth Beams: Depth of excavation for plinth beam shall be measured from ground level up to bottom of beam and width equal to width of the beam. If a leveling course is ordered, if shall be measured up to the bottom of the Leveling course.
c) Where excavation is made in trenches, measurements for cutting shall be taken by means of taps and staff and the width of concrete or rubble packing as shown on the Drawing shall be considered as the width of excavation.
Page 101 of 171 101d) Where excavation is made for leveling the site, levels shall be taken before start and after completion of work and total quantity of excavation computed from these levels in manner approved by the Architect.
e) Where soil including soft rock and hard rock are mixed, hard rock after excavation shall be stacked separately. Measurement of the entire excavation shall be taken as indicated above. Excavations of hard rocks shall be measured from stacks of excavated hard rock and reduced by 40% for bulkage and void. The quantity so arrived at shall be paid for under hard rock. The difference between the quantity of entire excavation and quantity payable under hard rock shall be paid as soil including soft rock.
2) Earth Filling :
In open spaces Fillings shall be measured from cross sections of embankments, levels of which are recorded by means of levels before start of work and after completion of work. When it is not possible to measure filling from cross sections, it may be measured from loose stacks or lorry measurements with previous written permission from the Architect and 20% deduction shall be made from the measured quantity to arrive at the net quantity payable.
3) Cement Concrete (Plain & Reinforcement):
Cement concrete in R.C.C. and P.C.C. items shall be measured exclusive of reinforcement and plaster thickness but shall include necessary costs of shuttering, centering, hire charges of all equipment, curing, hacking and fair finish. Reinforcement and plaster shall be measured and paid separately.
Items line R.C.C. precast jalli, R.C.C. pipes and other such items which are normally manufactured in factories as well as those items which have been specifically mentioned in the Bill of Quantities shall be measured inclusive of reinforcement.
No deductions will be made for openings up to 0.1 sq.mtr. and no extra labour for forming such openings or voids shall be paid.
Columns shall be measured from face to face of columns / beams and shall include haunches, if any. The depth of the beams (other than raft foundations beam) shall be measured from the top of the slab to the bottom of the beam.
In case of combined footings and raft foundations, the exposed, portion of the beam rib shall be measured as beam and remaining portion measured in footing / raft slab.
Slabs (other than in raft foundations) shall be measured in bays (clear of beams) with deductions for columns portions.
Chajja: only projected portion shall be measured in Square meter.
Staircase: Measurements shall be in Cu.m. Staircase comprising if steps, soffit slab, landing slab shall be measured and paid under this them. Side parapet walls, railings, finishing of raisers and treads, M.S.
reinforcement and plastering etc., shall be paid separately under respective items.
4) Reinforcement:
Page 102 of 171 102Shall be measured in lengths of bars as actually placed in position on standard weight basis; no allowance being made in the weight for rolling margin, Wastage and binding wire shall not be measured, authorised overlaps and spacers shall only be measured.
Standard weight for steel reinforcement bars Diameter of the steel bars in 6 8 10 12 16 20 25 32 mm.
Weight of steel bars in kg 0.22 0.39 0.62 0.89 1.58 2.47 3.85 6.31 per Rmt.
5) Brick Work :
Except walls of half-brick thickness or less, all brick work shall be measured in cubic meters.
Thickness of Wall:
Brick walls up to and including three bricks in thickness shall be measured in multiples of half-brick which shall be deemed to be inclusive of the mortar joints. Where fractions on half-bricks occur due to Architectural or other reasons, the measurement shall be taken half-bricks.
For walling, which is more than three bricks in thickness, the actual thickness of the wall be measured to the nearest centimeter.
Honey-combed brick walling shall be given in square meters stating the thickness of wall and the pattern of honey-combing. Honey comb openings shall not be deducted.
Deductions:
No deductions or additions shall be made on any account for a) Ends of dissimilar materials (i.e. joists, beams, lintels, lofts, grinders, rafters, purlins, trusses, corbels, steps, etc.) up to 500 square centimeters in section.
b) Opening up to o.1 sq. in section. c) Wall plates, bed plates and bearing of slabs, chajjas and the like where the thickness does not exceed 10 cm. and the bearing does not extend over the full width of the wall.
6) Stone Masonry :
Except where otherwise described, stone work and stone walling generally shall be given in cubic meters and facia work in square meters.
When measuring walls, the thickness shall be measured to the nearest one centimeter.
Deductions shall be made as described under brick work.
Page 103 of 171
1037) Wood Work:
All work shall be measured net as fixed. No extra measurement will be given for shape, joints, splayed meeting styles of doors and windows and shall be measured in unit of square meters.
Area over the face inclusive of exposed frame thickness (excluding width of cover mould) shall be measured in case of door, windows and ventilators when frames are included in the item. Portions embedded in masonry or flooring shall not be measured. Where frames are measured separately mode of measurement shall be as per C.P.W.D. practice or IS:1200.
8) Steel doors, windows, ventilators, louvers:
Clear area over one face inclusive of exposed frame shall be measured. Holdfasts or portions embedded in masonry or flooring shall be measured.
9) Steel rolling shutters and rolling grilles:
Clear width between side jambs and clear height between floor and bottom of lintel / beam shall be measured.
Hood shall not be measured separately. The rate should be inclusive of the cost of hood.
10) Flooring, Skirting, Dado:
Flooring shall be measured from skirting to skirting and where the wall surface is plastered or provided with Dado, it shall be measured from plaster to plaster or dado to dado.
11) Plastering and Pointing:
All plastering and pointing shall be measured in square meters unless otherwise described.
Net are of surface plastered shall be measured. No deductions will be made for ends of joints, beams, posts, etc., and opening not exceeding 0.5 Sq.mtr. each and no additions shall be made neither for reveals, jambs, soffits, sills, etc. of these openings nor for finishing the plaster around openings, ends, of joists, beam and posts, etc.
Full deductions will be made for door, window and ventilator from each side with adding jambs for door, window and ventilator.
12) Painting, White Washing, Colour Washing and Distempering:
All painting work shall be measured in square meters.
Page 104 of 171 104Net are of surface painted shall be measured. No deductions will be made for unpainted surfaces of ends of joists, beams, posts etc., and opening not exceeding 0.5 sq.mtr. each and no additions shall be made for reveals, jambs, soffits, sills, etc., of these openings.
Full deductions will be made for door, window and ventilator from each side with adding jambs for door, window and ventilator.
No coefficient will be considered for painting over sponge finished or sand faced plaster.
The following multiplying factors for obtaining equivalent areas shall be adopted.
No. Description of works How measured Multiplying Factor a) Wood paneled framed ledged, braces and Measured flat (not girthed) 1 1/8 (for each side). battened. including frame, edges, chawkats, cleats, etc., shall be deemed to be included in the i tem.
b) Wood flush part paneled and part. -- do – glazed or gauzed. 1 (for each side). c) Fully glazed or gauzed or glazed -- do -- ¼ (for each side). louvered ventilators / window / door. d) Fully venetioned of louvered (not with -- do -- 1 ½ (for each side).
g lazing). e) Weather boarding. Measured flat (not girthed 1 1/8 (for each side). supporting frame work shall not be measured separately). f) Trellis (or Jaffri) work one way or two Measured flat overall, no 1 (for each side).
ways. deduction shall be made for opening (supporting members shall not be measured s eparately) g) Guard bars, balustrades, gratings, grille --- do --- 1 (for painting all railings, grille partitions, etc. over).
h) M.S. gates & open palisades fencing, See note below 1 (for painting over door including standards, braces, rails, all). stays, etc. i) Steel rolling / alligator type shutters. Measured flat over jambs, 1 ¼ (for each side).
guides, bottoms, rails and locking arrangement etc. shall be deemed to be included in the item. j) Carved or enriched work. Measured flat. 2 (for each side). k) Fully glazed or gauzed steel windows or Measured flat. 1 ¼ (for all over).
partitions.
Note :
Page 105 of 171 105The height shall be taken from the bottom of the lowest rail, if the palisades do not go below it (or from the lower end of the palisades, if they project below the lowest rail) up to the top of the palisades, but not up to the top of the standards, if they are higher than the palisades. Similarly, for the gates, depth of roller shall not be considered while measuring the height.
Area painted over sand cement plaster, sponge finished / sand faced plaster / rough cast plaster area painted without considering any coefficient for painting over sand faced plaster
SECTION – C: WORKMANSHIP CLEARING OF SITE, EXCAVATION AND EARTH FILLING
Note: Workmanship for all items related to the construction work should be as per relevant I.S. Code.
General:
Trenches for wall foundations, column footings, raft foundations, pile caps, plinth beams, water tanks, cess pits, etc., shall be excavated to the exact length, width and depth shown in the figure on the drawing or as may be directed by the Architect. If taken out to greater length, width or depth than shown or required, the extra work occasioned thereby shall be done at the Contractors own expenses. Extra depth shall be brought up by plain cement concrete filling 1:4:8 proportion and extra length and width filled in by rammed earth or murum or if the Architect thinks it necessary for the stability of the work by 1:4:8 concrete, as may be directed by the Contractors costs.
Excavated material shall be used for filling in plinth, or each side of the foundation blocks or trenches or it shall be spread elsewhere on or near the site of work including watering, ramming and consolidating or carted away from site free of charge, as may be ordered.
The Contractor shall at his own expenses and without any extra charge, make provision for supporting all utility services, lighting the trenches, separating and stacking, serviceable materials neatly, shoring, timbering, stuttering, bailing out of water either sub-soil or rain water including pumping at any stage of the work. Trenches shall be kept free of water while masonry or any concrete works are in progress and until the Architects consider that concrete is sufficiently set.
PROTECTIONS–SHORING, PILE SHORING Excavation where directed by the Engineer-in- Charge shall be securely barricaded and provided with proper caution signs, conspicuously displayed during the day and properly illuminated with red lights and/or written using fluorescent reflective paint as directed by engineer in charge during the night to avoid accident.
The Contractor shall take adequate protective measures to see that the excavation operations do not damage the adjoining structures or dislocate the services. Water supply pipes, sluice valve chambers, sewerage pipes, manholes, drainage pipes and chambers, communication cables, power supply cables etc. met within the course of excavation Page 106 of 171 106shall be properly supported and adequately protected, so that these services remain functional. However, if any service is damaged during excavation shall be restored in reasonable time.
Excavation shall not be carried out below the foundation level of the adjacent buildings until underpinning, shoring etc is done as per the directions of the Engineer-in-Charge for which payment shall be made under the relevant item.
Any damages done by the contractor to any existing work shall be made good by him at his own cost. Existing drains pipes, culverts, over-head wires, water supply lines and similar services encountered during the course of execution shall be protected against damage by the contractor. The contractor shall not store material or otherwise occupy any part of the site in manner likely to hinder the operations of such services.
Mobilization shall be done for the DTH machine for micropile for drilling, equipment’s, accessories, personnel, etc. to the site including erection, commissioning, etc and demobilization of the same after completion of works as per specifications.Setting up works shall be undertaken.
Forming vertical piles by DTH drilling method through fill, boulders, all kinds of soils, hard murrum, soft rock, weathered rock, hard bedrock, with permanent steel liner up to non-collapsible strata and carting away excavated soil as per drawings and specifications.Providing steel casing upto rock for the micropiles. Fixing Reinforcement in piles as per drawings with Deformed Bars including Site Shifting, cleaning, cutting, bending, jointing, tying in position with binding wire, placing and maintaining in position as per drawings and specifications, complete. The rate shall include cost of labour, tools, etc.Casting capping beam with M25 grade ofconcrete as per drawings and specifications.
Providing, supplying, transportation and casting the piles with self-compacting concrete, having a min. compressive strength equivalent to M – 30 Grade(Self compacting concrete), with stone aggregate and minimum cementatious content as per IS codes and maximum water cement ratio as per IS 2911 Part 1 / Sec 2: 2010, as per specifications.
The rates shall include cost of all materials, concrete admixtures (if used with the prior approval of Engineer), tools, wastage, as required etc.Testing of all rock anchors with multi-strand jack as per design drawing.The rates quoted for shore piling shall include supply, fixing, all materials, labour etc complete as required for the execution of the item of works on site etc complete. The BOQ specifications would govern the works to be executed on site as per the directions and instructions of the Architect & Engineer in charge.
Excavation excluding in Hard Rock:
Excavation shall be carried out in any type of soil, murum (soft or hard), soft rock, boulders, old foundation, concrete asphalt or stone paved surfaces, old masonry or concrete (plain or reinforced).
Excavation in Hard Rock:
Rock which is in solid beds, which can only remove either by blasting or by wedging or chiseling shall be treated as hard rock. A boulder or detached rock measuring one cubic meter or more, shall blasting, wedging or chiseling.
Where hard rock is met with the blasting operations is considered necessary, the Contractor shall intimate about the same to the Architect.
Page 107 of 171 107The Contractor shall obtain license from District / Public authorities for carrying our blasting work as well as for obtaining transporting and storing explosives as per Explosives, Rules 1940 or as amended. He shall purchase the explosives, fuses, detonators, etc., only from a licenses dealer. He shall maintain the account of explosive etc., purchased and used by him. He shall be responsible for safe custody and proper accounting of explosives materials.
The Architect shall have access to check store of explosive and accounts thereof.
Blasting shall normally be done with gun powder. Dynamite Gelatin or any other high explosive shall only be used in special cases with written permission of the Architect and District / Public authorities concerned under Explosives Rules.
Blasting operations shall be carried out under the supervision of a responsible representative of the Contractor during certain hours, preferably during lunch break as approve in writing by the Architect. The representative shall be conversant with the rules of blasting.
Proper precautions for the safety of persons shall be taken. Red flags shall be prominently displayed around the area to be blasted and all people on work expect those who actually light the fuses shall be withdrawn to a safe distance of not less than 100 meters from the blast. Blasting shall not be done within 100 meters of an existing masonry or any other kind of structure unless special precautions are taken by heavy blanketing etc.
Where Blasting is not practicable or prohibited, excavation shall be done by wedging or chiseling and it shall be restricted to the quantity required to enable the necessary foundation etc. to the put in. In case, the dimension of trenches exceeds those shown in drawings or as directed by the Architect, the excess quantity shall not be paid for, the item also covers bailing out subsoil or rain water including pumping at any stage of work, shoring strutting, etc.
Earth Filling:
General: Filling shall be done with good earth, murum, stone chips, or disintegrated building debris. It shall be free from salts, organic matter, black cotton or slushy earth and combustible material. All clods shall be broken.
a) Filling in Plinth :
Filling shall be done in layers not exceeding 25 cm., amply watered and consolidated by ramming with iron or wooden rammers weighing 7 to 8 kgs. and having base 20 cm. square or 20 cm. diameter. When the filling reaches the finished level, surface shall be flooded with water for at least 24 hours, allowed to dry and then rammed and consolidated, after making good any settlement in order to avoid settlement at a later stage. Special care shall be taken to pack earth under plinth beams and column corners. Finished level of filling shall be kept to a slope intended to be given to the floor.
b) Filling in Outdoor portions and for Site Development:
Shall be done in layer of 30 cm. Each layer shall be adequately watered. When filling reaches the required level the top most layer shall be dressed to proper section, grade and camber and rolled by 8 to 10 ton’s power roller and adequately watered to aid compaction.
DRY RUBBLE PACKING & LEVELING COURSE.
Page 108 of 171 108Dry Rubble Packing: Ground shall first be leveled up and thoroughly consolidated by means of heavy log hammer or frog rams. Rubbles of specified thickness shall then be laid and set with hand. It shall be consolidated by either hand roller or wooden log hammer; free use of water being made during consolidation. All hollows and interstices after consolidation shall be filled up with quarry spalls, stone chips etc., and the packing blinded with stone grit and watered and consolidated by log hammer.
Rubble packing in Road work shall be thoroughly consolidated by means of power rollers of 8 ton’s capacity instead of log hammers and the surface shall be brought to proper grade and camber. After checking the level, grade and camber the surface will again be watered and rolled to receive road structure.
Leveling Course:
It shall be either plain cement concrete of leaner mix or lime concrete which shall be proportioned as stipulated in the relevant item and mixed and placed in position confirming to line and level show on the drawing and compacted by approved means and cured adequately.
Lime concrete shall be prepared by mixing sand and slaked lime in proportion of three parts of sand and one part of lime and ground in a suitable mill and the mortar so prepared shall be added to six parts of the brick bat passing through 50 mm. mesh, mixed well and placed in position and compacted by approved means. The concrete shall be cured adequately.
PLAIN & REINFORCED CEMENT CONCRETE A) VOLUMETRIC BASIS: -
General : Except where they are varied by the requirements of this specification due provision of Indian Standard Specification IS-456-1964 for plain and reinforced concrete and IS-432 part I and II for Mild and Medium Tensile steel Bars and hard drawn steel wire for concrete reinforcement and any other relevant ISS applicable together with the latest amendments shall be held to be incorporated this specifications. It shall be intent of these specifications to ensure that all concrete placed at various location of the job should be durable, strong enough to carry design, loads, it should wear well and practically be impervious to water. It should be free from such defects as shrinkage, cracking and honey-combing.
Proportioning the Mix :
In ordinary concrete, excluding controlled concrete, proportions of cement to fine and coarse aggregate shall be as specified in the respective items and shall be accurately measured as in table “A” below. These proportions are based on assumption that the aggregates are dry. If aggregates are moist allowance shall be made for bulking in
accordance with IS:2386/-. Allowance shall also be made for surface water present in aggregate when computing water contents. Surface water present shall be determined by one of the field methods described in IS:2386/- (Part III). In the absence of exact data, the amount of surface water may estimate by the value given in table “B” below (Table “A” and “B” please see on page nos.124 & 125).
Page 109 of 171 109Mixing :
Concrete of 1:2:4 or richer mix shall be mixed in an approved mechanical mixer. The mixer and mixing platform shall be suitably protected from wind and rain. Aggregates shall be accurately measured out in boxes and mixed dry along with cement, water shall be then added in measured quantity and mixing shall be continued until there is a uniform distribution of the materials and the mass is uniform in colour and in consistency but in no case shall he mixing be done for less than 2 minutes.
When hand mixing is permitted with the approval of the Architect it shall be carried out on water-tight mixing platform and care shall be taken to ensure that mixing is continued until mass is uniform in colour and consistency.
Consistency :
Quantity of water for making reinforced concrete shall be sufficient so as to ensure that concrete shall surround and properly grip all the reinforcement. The best consistency shall be that, which will flow sluggishly without flattening out and without separation of coarse aggregates from the mortar. The degree of plasticity shall depend on the nature of work and atmospheric temperature and whether the concrete is vibrated or hand compacted. The slumps shown in table “C” obtained
by standard slump test carried out in accordance with the procedure laid down in IS:119-1959 shall be adopted for different types of work.
Admixtures :
The usage of admixtures is allowed only if approved by the structural consultant and his decision in this regard shall be final.
Transportation:
Concrete shall be conveyed from the place of mixing to the place of final deposit as rapidly as practicable by methods which will prevent segregation or loss of any of the ingredients. If segregation does occur during transport, the concrete shall remix before being placed. In no case, more than 30 minutes shall elapse between mixing the consolidation in its position.
Placing and Compacting :
Concrete shall be placed in layers of suitable thickness or in strips and compacted before initial setting commences and should not be subsequently disturbed. Method of placing shall be such as to preclude segregation and as far as practicable the placing shall be continuous. Special care shall be taken in accordance with IS:456 while laying concrete under extreme weather.
Concrete shall be thoroughly compacted during the operation of placing and thoroughly working around the reinforcement, embedded fixtures and spaded against corners of the form work and by punning, rodding, mechanically vibrating or by any other approved means. In addition, form work shall be tapped lightly by using wooden mallet at the pouring head. The number and type of vibrator to be used shall be subject to the approval of Page 110 of 171 110the Architects and in general immersion type vibrators shall be used. External vibrators shall also be used whenever directed.
The intensity and duration (of vibration shall be sufficient to cause complete settlement and compaction without any stratification of successive layers or separation of ingredients or formation of laitance. Vibrator shall be inserted vertically in the concrete at points not more than 45 cm. apart and withdrawn very slowly when air bubbles no longer come on the surface. Over vibration or vibration of very wet mixes is harmful and should be avoided.
Care shall be taken to utilize the vibrator only to compact the concrete and not to spread it, sufficient number of reserve vibrator in good working condition shall be kept on hand at all times, so as to ensure that there is no slackening or interruption in compacting.
Construction Joints :
Concreting shall be carried out end to end continuously as far as possible and when construction joints are totally unavoidable, it shall be located in a predetermined position approved by the Architect. The joints shall be kept at places where the shear force is the minimum and these shall be straight and at right angles to the direction of main reinforcement. When the work has to be resumed, on a surface which has hardened, such surface shall be roughened.
It shall be swept clean, thoroughly wetted and covered with a 13 mm. layer of mortar composed of cement and sand in the same ration as the cement concrete mix. This 13 mm. layer of mortar shall be freshly mixed and placed immediately before the placing of the concrete.
Where the concrete has not fully hardened, all laitance shall be removed by scrubbing the Wet surface with wire or bristle brushes, care being taken to avoid dislodgment of particles of aggregate. The surface shall then be coated with neat cement grout. In horizontal joints the first layer of concrete to be placed on this surface shall not exceed 15 cm. thickness and shall be well rammed against old work, particular attention being paid to corners.
Expansion Joint:
Expansion joint shall be provided where required as shown on the drawings or as directed by the Architect / Consultant. The joints shall be filled by the approved quality filler.
Curing :
Concrete shall be carefully protected during first stage of hardening from harmful effects of excessive heat, drying winds, rain or running water. It shall be covered with a layer of sacking, sand canvas, hessian, or similar absorbent materials and kept constantly, wet for ten days from the date of placing of concrete. Alternatively, the concrete being thoroughly wetted and covered by layer of approved water-proof material which should be kept in contact with it for seven days.
Form Work :
The form work shall conform to the shape, lines and dimensions as shown on the plans and be so constructed as to remain sufficiently rigid during the placing and compacting of the concrete and shall be sufficiently watertight to prevent loss of cement slurry from the concrete. Form work or centering shall be constructed of steel or timber and Page 111 of 171 111adequately designed to support the full weight of wet concrete without deflection and retain its form during laying, ramming and setting of concrete. Timber used shall be properly seasoned so as to prevent deformation when wetted.
All props shall be straight and of full height and no joints shall be allowed. Props shall be braced with thin bamboos or wooden battens and where additional staging is necessary, extra care shall be taken to use bigger diameters props with bracing at 4 or 5 levels. All props shall be supported on sole plates and double wedges. At the time of removing props these wedges shall be gently eased and not knocked out.
All rubbish, chippings, shavings and saw dust shall be removed from the interior of the forms before the concrete is placed and the form work in contact with the concrete shall be cleaned and thoroughly wetter or treated with non- staining mineral oil or any other approved materials is kept out of contact with the reinforcement.
All form work shall be removed without shock or vibration and shall be eased off carefully in order to allow the structure to take up its load gradually. Forms shall not be disturbed until concrete has adequately hardened to take up superimposed load coming on it and in no circumstances shall forms be struck until the concrete may be subjected at the time of striking.
In the normal circumstances (generally where temperatures are above 21 degrees centigrade) and where ordinary cement is used, forms may be struck after expiry of following periods : a) Walls, Columns and Vertical sides of beam} 48 hours as may be directlyby the Architect b) Bottom of slab up to 4.5 m. span. 7 days.
c) Bottom of slab up to 4.5 m. span. 14 days. bottom of beam and arch rib up to 6 m. span. d) Bottom of beams and arch 21 days. rib over 6 m. span.
However, this period may be increased or decreased at the discretion of Architects. Special care shall be taken while striking the centering of cantilevered slab canopies, portal frames, folded plate construction and period of striking centering shall be as determined by the Architect.
If directed, form shall be given an upward camber to ensure that the beams do not have any sag. Surface that becomes exposed on removal of forms shall be carefully examined and any fins, burrs, projections etc., that are detected shall be removed. Any honeycombing of minor nature shall be finished neatly with cement mortar 1:2.
Any work showing signs of damage through premature or careless removal of centering or shuttering, shall be reconstructed by the contractor at his own cost.
Strength :
Concrete mixed in the proportion desired shall have compressive strength after placing, not less than the following:
Page 112 of 171 112No Concrete Mix. Minimum compressive strength Minimum compressive @ 7 days strength @ 28 days 1 1:1:2 160 Kg. / Sq.mtr. 250 Kg. / Sq.mtr. (2250 Lbs. / Sq. inch). (3500 Lbs. / Sq. inch).
2 1:1½:3 132 Kg. / Sq.mtr. 200 Kg. / Sq.mtr. (1875 Lbs. / Sq. inch). (2850 Lbs. / Sq. inch).
3 1:2:4 106 Kg. / Sq.mtr. 150 Kg. / Sq.mtr. (1500 Lbs. / Sq. inch). (2250 Lbs. / Sq. inch).
Tests :
Tests on concrete shall be carried out in accordance with IS-456/- and any other is applicable. The frequency of work test shall be at such intervals as ordered by the Architect and subject to that every 150 cu.m. of concrete placed or part thereof and for a day’s concrete exceeding 30 cu.m. a batch of 6 cubes shall be made for every sample and 3 of them tested after 7 days and the remaining 3 cubes shall be tested after 28 days. The criteria for acceptance of a concrete as confirming to a specified proportion / grade of concrete shall be in accordance with IS:456 and the Contractor shall entirely re-do the rejected work at his own cost. Strength of 28 days shall alone be considered for acceptance.
The Contractor shall arrange to carry out the tests in accordance with the relevant Indian Standards Specifications in an approved laboratory and the test reports in original be submitted to Architect. The entire cost of testing shall be borne by the Contractor.
Steel Reinforcement :
Reinforcement shall be accurately fabricated, placed and adequately maintained in position as shown on the drawings or as directed by the Architect. All finished bars shall be free from cracks, surface flaws, laminations, jagged and imperfect edges. Cement mortar blocks shall be used to give requisite cover as shown be firmly tied with binding wire of 16 to 18 gauge. Reinforcement shall be bent in accordance with the procedure stipulated in IS:2502- 1963 and will not be straightened in a manner which will injure the material.
All reinforcement shall immediately before placing in concrete be thoroughly cleaned of loose mill scale, loose rust, oil and grease or other deleterious matter that would destroy or reduce bond.
Reinforcement in reinforced concrete members shall not be connected by welding or coupling except in accordance with relevant ISS and with the previous approval of the Architect. Overlaps and joints shall be staggered and located at points, along the spans where neither shear nor bending moment is maximum.
Cover :
Reinforcement shall have cover as shown on the R.C.C. drawings and where not specified the thickness of cover shall be as follows. Cement mortar blocks in C.M. 1:1 shall be used for making cover blocks.
Page 113 of 171 113a) At each end of reinforcing bar not less than 25 mm. not less than twice the diameter of such rod or bar. b) For a longitudinal reinforcing bar in a column not less than the diameter of such rod or bar. In the case of columns of minimum of 20 mm. or under whose reinforcing bars do not exceed 13 mm. the cover of 25 mm.
may be used. c) For longitudinal reinforcing bar in a column not less than 25 mm. not less than diameter of such rod or bar. d) For tensile, compressive, shear or other reinforcement in a slab not less than 13 mm. nor less than diameter of such reinforcement, and e) For ant other reinforcement not less than 13 mm. not less than the diameter of such reinforcement.
A) WEIGH-BATCHING BASIS i.e. (DESIGN MIX CONCRETE):
Workmanship of Design Mix Concrete shall be carried out in accordance with I.S:456 – 2000 and any other I.S. Code is applicable.
TABLE – A No Nominal Mix. Quantity of aggregates required per 50 Quantity of water required per 50 kgs kgs of cement. of cement.
Fine Cu.m. Coarse Cu.m. Vibrated Un-vibrated (For dry aggregate) 1 1:1:2 0.035 0.070 22 lit. 27 lit. (1.2 C.ft.) (2.4 C.ft.) (4.8 Gal.) (6 Gal.) 2 1:1½:.3 0.052 0.106 23 lit. 30 lit. (1.8 C.ft.) (3.6 C.ft.) (5 Gal.) (6 Gal.) 3 1:2:4 0.070 0.138 27 lit. 32 lit.
(2.4 C.ft.) (4.8 C.ft.) (6 Gal.) (7 Gal.) 4 1:3:6 0.105 0.210 28 lit. 34 lit. (3.6 C.ft.) (7.2 C.ft.) (6.25 Gal.) (7.5 Gal.) 5 1:4:8 0.150 0.280 -- 45 lit. (4.8 C.ft.) (9.6 C.ft.) -- (10 Gal.) TABLE – B No Aggregate Approx. quantity of surface water in Lit / Cu.m.
1 Very wet sand. 120 2 Moderately wet sand. 80 3 Moist sand. 40 4 Moist gravel or crushed sock. 20 to 40 Coarser the aggregate, lesser the water it will carry.
Page 114 of 171 114TABLE – C No. Type of Work SLUMPS When vibrated When not vibrated
1. Mass concrete in R.C.C. foundation footings.2 .5 cms. 5 cms. (1”) (2”)
2. Beams, slabs, columns with simpl2e. 5 cms. to 5 cms. 5 cms. to 10 cms. reinforcement. (1” to 2”) (2” to 4”)
3. Thin sections with congested reinforcement. 5 cms. to 10 cms. 10 cms. to 15 cms. (2” to 4”) (4” to 6”)
Note: Should conditions governing slump and workability changed pointing to advisability of an increased slump, this shall only be done by decreasing the amount of aggregate and not by increasing the amount of water.
B) WEIGH-BATCHING BASIS i.e. (DESIGN MIX CONCRETE):- Workmanship for design mix concrete shall be carried out in accordance with I.S. 456-2000 and any other I.S. code is applicable.
BRICK AND STONE MASONRY
General :
All brick work should be carried out as shown on the drawings with setbacks, projections, cuttings, toothings, etc.
Wherever the proportion of cement mortar has not been specifically mentioned, cement mortar in the proportion of 1:6 shall be used. Flat bricks arches shall be provided wherever required without any extra cost. Brick work shall be kept wet while in progress, till mortar has properly set. On holidays or when work is topped, top of all unfinished masonry shall be kept wet. Should the mortar become dry, white or powdery, for want of curing work shall be pulled down and rebuilt at the Contractor’s expenses.
Brick Work 1stClass:
Bricks shall be thoroughly cleaned, well wetted and soaked for at least twelve hours in fresh water before being used on the work. Bricks shall be of locally, available best quality.
English bond shall be used throughout in walling. A good bond shall be maintained throughout the work, both laterally and transversely. In walling, the courses shall be kept perfectly horizontal and in plumb with the frogs facing upwards. Vertical joints shall not exceed 10 mm. thickness and shall be full of mortar. No broken bricks shall be used except as closers. After day’s work all joints shall be raked to 12 mm. depth to provide for proper key to plastering.
Page 115 of 171 115Mortar used shall be as specified in respective items and every third course of brick work shall be flushed with mortar grout.
Whole of the masonry work shall be brought up at one uniform level throughout the structure; but where breaks are unavoidable, joints shall be made in good long steps. All junctions of walls and cross walls shall be carefully bounded into the main walls. The rate of laying masonry may be up to a height of 60 cm. per day if cement mortar is used and 45 cm. per day if lime mortar is used. Greater heights may be built only if permitted by the Architect.
During rains, the work shall be carefully covered to prevent mortar from being washed away. Should any mortar or cement be washed away, the works shall be removed and rebuilt at the Contractor’s expenses.
Bricks Work 2ndClass:
Shall be similar to 1st class brick work except that 2nd class bricks shall be used and joints shall be 10 mm. t0 12 mm. thick.
Half Brick Masonry :
Shall be set in cement mortar as specified. Hoop iron bands of 2.5 cm. x 0.16 (1” x 1/16”) shall be embedded in every fourth course with thick mortar band or 2 Nos. 6 mm. (1/4”) dia. bars shall be used in every sixth course otherwise as specified under item.
RUBBLE MASONRY
General :
Stones shall be of the kind specified in the item and shall be from an approved quarry. Stones shall be well wetted before laying in position. The mortar shall be as specified in the item. Face stone shall not be less than in breadth than in height, it shall also tail into the work more than its height. Jambs of doors, windows and openings shall be formed with quoins. In case of battered walls, the courses on battered surface shall be at right angle to the batter.
Through stones or headers shall be laid in every course at a distance not exceeding 2 meters part and shall be staggered. They shall be in one piece for walls up to 1.5-meter width and shall be lap jointed in case of wall having thickness more than half meter. The face area of each header shall not be less than 0.50 sqm. 1:2:4 cement concrete may also be allowed where good length headers are not available. Headers shall be marked with oil paint for ready identification.
Height of quoins shall be same as that of the course. Length of quoins shall be 0.50 m. and shall be laid header and stretcher alternatively. Faces of quoins shall be fair dressed. No quoins stones shall be less than 0.30 cum. In content.
Joints of masonry shall be raked out and unless otherwise stated, shall be raised cement pointed by using cement mortar 1:1 to all exposed surfaces. All masonry work shall be well watered for a period of seven days.
a) Coursed Rubble Masonry – First Sort :
Page 116 of 171 116Height of course shall not be less than 15 cm. and all courses shall be of uniform height. All stones in the course shall be of same height. In no case height of course shall be more than any of the course below it. Bed and sides shall be hammer or chisel dressed back from the face 75 mm. and 35 mm. respectively.
Faces of stones shall be hammer dressed and bushing shall not be more than 35 mm. Thickness of joints shall not be more than 10 mm. Stones shall break joints at least half the height of the course. Work on interior face shall be precisely the same, as on exterior face.
Quoins shall be at least 0.5 m. long laid square on their beds and shall be fair dressed to a depth of at least 10 cm. b) Uncoursed Rubble Masonry :
Stones shall be hammer dressed. Nearly fifty per cent of stones shall not be less than 0.30 cum. in content each, and twenty-five per cent of stone shall tail back in masonry by 40 cm. or more. Stones shall be so arranged as to break joints as much as possible.
Long vertical joints shall be carefully avoided. Thickness of joints shall in no case exceed 12 mm.
Pillar offsets shall be properly dressed with hammer or chisel to form proper angle. Stones used for the backing shall be of fairly large size. c) Random Rubble Masonry – First Sort :
Stones shall be roughly chisel dressed. They shall be solidly bedded in mortar. Height of stone shall not be more than width of face or length of tail. Stones shall be of equal size and so arranged as to break joints as much as possible, avoiding long lines of horizontal or vertical joints. Quoins shall be same as described in Coursed Rubble Masonry – 1st Sort. All stones shall be carefully fitted. Thickness of face joint shall be not exceeded 25 mm. Edges of stones shall be chisel dressed for fitting in position properly.
WOOD WORK Timber used shall conform to specifications described under Materials, Doors, Windows, Ventilators, walls, Paneling, False Ceiling, etc., shall be in accordance with Architect’s drawing in every detail and all joiner’s work shall be accurately set out, framed and finished in a proper workman-like manner, frames of doors, windows and ventilators etc. and shutter styles and rails shall be best solid teak of quality specified in the Bill of Quantities. The scantlings shall be accurately planed smooth, rebates, rounding and mouldings shall be made as shown on the drawings, patching or plugging of any kind shall not be allowed. Joints shall be simple, neat and strong. Framed joints shall be coated with suitable adhesive like glue or synthetic resin before the frames are put together. All mortice and tenon joints shall be fit and fully and accurately without wedging on filling. The joints shall be pinned with hard wood or bamboo pins of 10 mm. to 12 mm. dia. or rust resisting star shaped metal pins 8 mm. after the frames are put together and pressed in position by means of press. The frames are put together and pressed in progress of work by suitable boxing. All portions of timber abutting against or embedded in masonry or concrete shall be treated against termites by giving a coat of any approved wood preservative.
Unless otherwise specified all doors, frames shall have six M.S. flat holdfasts and window frames shall have four holdfasts shall be provided to the ventilators, if directed. Size of holdfasts shall be 30 mm. x 40 mm. x 6 mm. M.S.
Page 117 of 171 117flat bent to shape worth fish tail end and it shall be fixed to frame with sufficient number of screws as directed.
When door / window frames are to be fixed to R.C.C. column or R.C.C. wall, holdfasts shall be substituted by suitable arrangements such as coach crews, rawl bolts etc., to secure frames to R.C.C. column or R.C.C. wall as directed by the Architect.
Frames and shutter shall not be painted or erected before being approved by Architect.
Panelled Shutter :
Panels shall be of pattern and size as shown on the drawings or as directed by Architect. Solid teak wood panels shall be in one piece wherever possible. Where two or more pieces are permitted, they shall be of equal width.
Panels shall be framed into grooves made in styles and rails to the full depth of groove and faces shall be closely fitted to sides of groove.
Where panels specified are block board, it shall be solid core with teak internal lipping and of approved make.
Partly paneled and partly glazed shutter shall be similar to paneled shutters except that such parts as are directed shall be glazed with plain or ground glass as specified. Styles and rails shall be rebated 12 mm. to receive glass.
Sash bars shall be moulded and rebated and mitered on sides to receive the glass which shall be fixed with putty and beads.
Hardware Fittings :
Unless otherwise specified all hardware, fittings and fixtures shall be supplied by the employer free of charge.
However, the cost of fixing fittings shall be included in the rate quoted. The fixing shall be done in the best workman-like manner in accordance with the manufactures specifications. The Contractor shall be held responsible for working of all moving parts dependent on proper fixing. He will also be responsible for any breakage due to negligence during fixing or lack of protection before the building is handed over. The Contractor shall also take delivery of all hardware fittings etc., as and when supplied and arrange for safe storage etc.
Hardware required for fixing false ceiling, wall paneling etc., shall be arranged by the Contractor at his cost. Apart from the hardware fittings required for the joinery items, the Contractor shall have to fix all other items of hardware fittings to be supplied by the employer viz. coat / picture hooks, numerical, letters to denote buildings, hanging rods etc., as directed by the Architects.
Painting and polishing of wood work shall be as per specifications under respective heads.
Flush Doors:
All flush doors shall be solid core unless otherwise specified. It shall conform to the relevant specifications of I.S.
2202 and shall be obtained from approved manufactures. The finished thickness of the shutter shall be mentioned in the items. Face veneers shall be of the pattern and colour approved by the Architect and an approved sample shall be deposited with the Architect for reference.
The solid core shall be wood laminae prepared from battens of well-seasoned and treated good quality wood having straight grains. The battens shall be of uniform size of about 2.5 cm. width. Theses shall be properly glued and Page 118 of 171 118machine pressed together, with grains of each piece reversed from that of adjoining one. The longitudinal joints of the battens shall be staggered and no piece shall be less than 50 cm. in length. Alternatively, the core shall be of solid teak particle board. Edges of the core shall be lipped internally with 1st Class teak wood battens of 4 cm. (1.5”) minimum depth, glued and machine pressed along with the core.
The core surface shall then have two or three veneers firmly glued on each face. The first veneer (called cross band) shall be laid with its grains at right angles to those of the core and the second and the third veneers with their grains parallel to those of the core. The under veneers shall be of good quality, durable and well-seasoned wood. The face veneers shall be of minimum 1 mm. thickness and of well-matched and seasoned 1st class teak, laid along with grains of the core battens. The combined thickness of all the veneers on each face shall not be less than 4 mm.
Thermosetting synthetic resin conforming to I.S. 303 or moisture-proof plywood grade MPF.I. shall be used in manufacture.
In addition to internal lipping all doors shall have external lipping all round.
STEEL DOORS, WINDOWS, VENTILATORSROLLING SHUTTER, M.S. GRILLES ETC.
Steel used in the manufacture of rolled steel sections shall not have more than 0.060 per cent of Sulphur and 0.065 per cent of phosphorus. The carbon content shall not exceed 0.30 per cent and shall be of weldable quality. In all other respects, the rolled steel sections shall conform to I.S. 226-1955 and I.S. 1977-1962.
Frames shall be square and flat. Both the fixed and openable frames shall be constructed of sections which have been cut to length, mitred and electrically welded at corners. Sub-dividing bar units shall be tenoned and rivetted into the frames. All frames shall have the corners welded to a true right angle and welds shall be neatly cleaned off.
Couplings, mouldings and weather bar shall be provided as directed by the Architects.
Outer frames shall be provided with fixing holes centrally in the web of the sections and fixing screws and lugs shall be used for fixing the frame to masonry. Mastic cement shall be used for making the joints watertight.
Hinges shall be strong projecting type. If directed friction type hinges shall be used in which case windows shall not be fitted with peg stays.
Projecting type hinged shutter shall be fitted with bronze or brass peg stays, 30 cm. long with peg and brackets welded / riveted to the frame or as sated under item.
All windows shall be provided with handles of brass or bronze or otherwise as stated under them.
Top hung ventilators shall be fixed with plain hinges rivetted / welded to the fixed frame. A brass or bronze peg stay 30 cm. long as in windows shall be provided or as stated under item.
Centre hung ventilators shall be hung on two pairs of brass or leaded tin bronze cup pivots rivetted to the inner and outer frames of the ventilators to permit the ventilators to swing through an angle of approximately 85. The opening position of the ventilator shall be so balanced to keep it open at any desired angle under normal weather conditions.
A bronze spring catch shall be fitted in the center of the top bar of the ventilator for the operation of the ventilator.
This spring catch shall be secured to the frame with brass screws and shall close into a mild steel malleable iron catch plate rivetted or welded to outside of the outer ventilator frame bar. A brass cord pulley wheel in mild steel or malleable iron brackets shall be provided along with card eye.
Page 119 of 171 119The windows and ventilators shall be painted. All the steel surfaces shall be thoroughly cleaned free of rust, scale or dirt and mill scale by picking or phosphating and before erection painted with one coat of approved primer and after erection painted with two finishing coats of synthetic enamel paint of approved shade and quality.
Glazing of specified thickness shall be provided on the outside of frames and unless otherwise specified, metal beading of approved shape, and section shall be used for fixing glasses. Special metal sash putty of approved make shall be used, if directed.
Rolling Shutters:
Shall be of approved manufacture suitable for fixing in the position ordered i.e. outside, inside, on or below lintel or between jambs. Shutters up to 12 sqm. (130 Sq.ft.) in area shall be manually operated or Push Up type while bigger sizes shall be of reduction gear type mechanically operated chain or handles.
These shall be consisting of 8 gauges or as specified with 75 mm. (3”) M.S. laths of best quality mild steel strips machine rolled and straightened with an effective bridge depth of 16 mm. (5/8”) and shall have convex corrugation.
These shall be interlocked together throughout their entire length with end locks. These shall be mounted on specially designed pipe shaft.
The spring shall be of approved make coiled type. These shall be manufacture from tested high tensile spring steel wire or strip of adequate strength to balance the shutters in positions. The spring pipe, shaft etc., shall be supported on strong M.S. or malleable cast iron brackets.
Both the side guides and bottom rail shall be jointless and of single piece of pressed steel.
Top cover of shaft, spring etc., shall be of the same material as that of lath.
For rolling shutter with wicket-gate, night latch shall be provided free of cost.
The shutter and cover etc., shall be painted with one coat of anti-corrosive paint and two coats of synthetic enamel paint of approved quality and shade.
Collapsible Steel Gate:
It shall consist of vertical double channels at 10 cm. centers. The sizes of channels T-Section for top and bottom shall be as approved by the Architects. The gate shall be provided with necessary bolts, nuts, locking arrangements, stoppers and brass handles on both sides. The gate shall be painted with one coat of anti-corrosive paint before erection and two coats of synthetic enamel paint of approved quality and shade.
Wrought Iron Grilles:
Grilles hall be manufactured as per drawings and the welded joints shall be smooth. The grilles shall be painted with one coat of anti-corrosive paint before fixing and two coats of synthetic enamel paint of approved quality and shade.
Aluminum Doors, Windows, Ventilators & Partitions etc.:
Page 120 of 171 120These shall be obtained from approved and established manufactures and shall be of Aluminum alloy conforming to I.S. 733 and sections shall generally conform to I.S. 1948. Theses shall be fabricated as per the details drawings, Frames for windows, ventilators etc., shall be square and flat. Both fixed and openable frames shall be constructed of section which have been cut to length, mitred and welded at corners. Sub-dividing bars shall be tenoned and rivetted into the frames. All frames shall have corners welded to a true right angle. For side hung shutters, hinges shall normally be of projecting type made of Aluminum alloy and rivetted / welded to frames. Handles, peg stays etc., or approved quality Aluminum or its alloy conforming to IS Specifications.
All types of shutters shall be fabricated, supplied and fixed as specified in the IS:1948. The rate shall include supplying and fixing all fittings and fixtures required for proper and safe operation.
The doors shall be fabricated by using standard aluminum alloy extruded sections as specified in IS:1948. The rate shall include supplying and fixing all fittings and fixtures including approved locking arrangement as directed.
All aluminum fabricated work shall be anodized to the British Standard 1616:1961 to give an anodized film of 25 micron.
The Contractor shall take to stack the fabricated frames etc., on site under cover. They shall be handled with care, stacked on edge on level bearers and supported evenly. Before erecting, the frames coming in contact with concrete, masonry, plaster of dissimilar metals shall be coated with a coat of Zinc Chromate conforming to IS:104-1950. The Contractor shall cover all anodized finish work with a thick layer of clear transparent lacquer based on methacrylate or cellulose butyrate to protect the surface from wet cement during installation. This coating shall remove on completion. Before handing over, the aluminum work shall be washed with mild solution of non-alkali soap and water.
Glazing:
Glazing shall be approved especially quality glass of specified thickness and unless otherwise directed it shall be
provided the exterior with metal beading.
FLOORING, SKIRTING, DADO AND STONE VENEERING All flooring, skirting, dado and stone veneering etc., shall be executed strictly as per relevant IS Specification and in workman-like manner.
Indian Patent Stone:
Selection of materials, method of mixing, placing and compacting shall generally conform to the specifications under plain and reinforced cement concrete described earlier. A stiff mix consistent with workability shall be used.
Preparation of Surface:
Before the operation for laying topping is started the surface of base concrete shall be thoroughly cleaned of all dirt, loose particles coked mortar droppings and laitance if any, by scrubbing with coir or steel wire brush. Where the Page 121 of 171 121concrete has hardened so much that roughening of surface by wire brush is not possible, the surface shall have roughened by chipping or hacking at close intervals. The surface shall then be cleaned with water and kept wet for 12 hours and surplus water shall be removed by mopping before the topping is laid.
Laying:
The screed strips shall be fixed over the base concrete dividing it into suitable panels. Before placing the concrete for topping, neat cement slurry shall be thoroughly brushed into the prepared surface of the base concrete just ahead of the finish. Concrete of specified proportion and thickness shall be laid in alternate panels to required level and slope and thoroughly tamped.
Finishing the Surface:
After the concrete has been fully compacted it shall be finished by troweling or floating with neat cement rendering.
Finishing operations shall start shortly after the compaction of concrete and the surface shall be troweled three times at intervals so as to produce a uniform and hard surface. The satisfactory resistance of floor to wear depends largely upon the care with troweling is carried out. The time intervals allowed between successive troweling is very important. Immediately after placing cement rendering, only just sufficient troweling shall be done to give a level surface. Excessive troweling in the earlier stages shall be avoided as this tends to bring a layer rich in cement to the surface. Sometime, after the first troweling, the duration depending upon the temperature, atmospheric conditions and the rate of the set of cement used, the surface shall be re-troweled to close any pores in the surface and to bring to surface and to scrape off any excess water in concrete or laitance. No dry cement shall be used directly on the surface to absorb moistures or to stiffen the mix. The final troweling shall be done well before the concrete has become too hard but at such time that considerable pressure is required to make any impression on the surface.
If directed by the Architect, approved mineral pigment shall be added to the rendering to give desired colour and shade to the flooring at no extra cost.
When instead of 1:2:3 or 1:2.5:3.5 mix, 1:2:4 is specified the topping shall be rendered with 1:1 cement mortar with a suitable mineral pigment, if directed, instead of cement only. If specified in the Bill of Quantities, the flooring shall be machine polished as per the Architect’s instructions.
Wherever the patent stone flooring is used as finishing on roof the joints shall be filled with an approved bitumastic filler in workman like manner.
Ironite Topping:
Instead of finishing the top with rendering coat of 1:1 cement mortar, the top shall be finished with 12 mm. thick ironite topping. Unless otherwise specified, one part of ironite and four parts of ordinary cement by weight shall be mixed dry thoroughly. This dry mixture shall be mixed with stone grit 6 mm. (1/4”) and down size or as otherwise directed in the ratio of 1:2 by volume and well turned over. Just enough water shall be added to this dry mix and mixed thoroughly well and laid to uniform thickness of 12 mm. and compacted. After initial set has started the surface shall be finished as directed.
Plain and Coloured Cement Tiles, Marble Mosaic and Terrazzo Tiles Flooring:
Page 122 of 171 122The tiles shall conform to IS : 1237 having the colour approved the Architect and the rate shall include provision of border tiles and tiles of different colours in pattern if directed. The mosaic topping of lighter shade tiles shall be made of White Cement with an approved shade pigment and neutral shade shall be of Grey cement with an approved shade pigment. The type of tiles shall be as specified in respective items.
The sub-grade shall be thoroughly wetted after cleaning of all dirt, laitance, and loose material. A bed of lime mortar consisting of one part of lime and two parts of sand shall be laid and properly leveled to an average thickness of 25 mm. and the surface shall be kept slightly rough to form a satisfactory key for tiles. Neat cement paste of honeylike consistency shall be spread over mortar bed, over such area at a time as would accommodate about 20 tiles. Tiles shall be soaked in water for 15 minutes and allowed to dry for the same duration. Tiles shall then be fixed with a thin coat of cement paste on back of each tile and then each tile being gently tapped with a wooden mallet till it is properly bedded and in level with adjoining tiles. Joints shall be fine and as imperceptible as possible.
After tiles have been laid in a room or a day’s fixing work is completed, surplus cement grout that may have come out of the joints may be wiped off gently and joints cleaned. A thin slurry of coloured cement matching to the colour of tiles shall be spread over it and rubbed so as to seal even a thinnest joint between the tiles and make it impervious and the flooring cured for 7 days. The tiles shall be polished
and finished according to IS:1443.
Dado, Skirting and Risers:
Tiles shall conform to IS:1237 and shall be of approved design. The tiles shall be fixed near cement grout on a blacking coat consisting of 1:4 cement sand plaster of 15 mm. thick. The top and bottom junctions of tiles shall be rounded off neatly as directed. The joints shall be filled with matching shade coloured cement slurry. The surface shall be kept wet for 7 days and then polished with carborundum stone to obtain smooth surface and fine polish.
Shahabad / Tandur / Kotah / Cuddappa Stone Flooring :
The flooring shall be either with rough stone or machine cut and machine polished as specified in respective items and shall be of specified thickness and of approved quality and size, free from cracks and flakes and shall be uniform in colour with straight edges. The sides of machine cut and machine polished stone shall have perfect right angles and surface smooth. The stone slabs shall be laid and finished as described under plain cement or colour cement tiles on a bedding of 1:2 lime mortar 25 mm. (Average) thickness. The finished stone surface thus laid shall then be polished to the required degree as approved by the Architect.
In Dado, Skirting, Risers etc.:
Stone slabs shall be laid on backing plaster of cement mortar 1:4 of 15 mm. to 20 mm. thick and finished as described under plain and coloured cement tile dado.
Marble mosaic / Terrazzo in situ work in flooring, dado, skirting etc.:
The terrazzo / mosaic finish shall be laid on an under layer of thickness as specified in the respective items. The topping shall consist of a layer of marble chips of selected sizes, colour and design approved by Architect, mixed with cement with desire shade of pigment.
Page 123 of 171 123For lighter shade mosaic. terrazzo white cement shall be used and for neutral shade, grey cement shall be used. The proportion of terrazzo mix shall be three parts of cement one part of marble powder by weight. For every part of cement marble powder mix, the proportion of marble aggregate by volume shall be 1.5 parts unless otherwise specified.
The topping shall be mixed and laid in panels as described in IS:2114 and as per decorative designs prepared by Architects. The dividing strips of panels shall be Aluminium or as specified in the Bill of Quantities. It shall be
polished as specified in IS: 2114.
Broken Mosaic Flooring:
Broken mosaic finish shall be laid on an underlayer of thickness as specified in the item.
Pieces of mosaic tiles shall be obtained from broken marble mosaic tiles of approved shade conforming to IS:1257.
The sizes of pieces shall be suitable to obtain the desired pattern of flooring as shown on the drawings or as approved by Architect.
Broken pieces shall be thoroughly wetted before fixing them. Ordinary or coloured cement grout shall be spread on the bedding. Mosaic tile pieces shall be fixed piece by piece to the desired pattern. The flooring shall be laid to correct level and slopes and compacted by straight screed tamper. The grout shall cream up to the surface. The junctions of the flooring and the wall shall be rounded and the flooring shall be extended along the wall to about 15 cm. (6”). After the day’s work, the surplus cement grout that may have come out of the joints shall be cleaned off.
The flooring shall be cured for seven days and then polished with a machine as stipulated in IS:1443.
Broken China Mosaic:
Broken China Mosaic flooring shall be exactly as per broken mosaic tile flooring except that the broken pieces shall be of China of approved colour and manufacturer and the floor shall not be polished.
Marble Flooring:
Marble slabs shall be of the best Indian marble of White or other approved colour as specified in the item. They shall be hard, dense, uniform and homogeneous in texture. They shall have even crystalline grain and free from defects and cracks. The surface shall be machine polished to an even and perfectly plane surface and edges machine cut true to square. The rear face shall be rough enough to provide a key for the mortar.
No slab thinner than the specified thickness at its thinnest part. The sizes of the slabs shall be as specified in the respective items.
The slabs shall be paid as described under mosaic tile flooring in every respect.
White Glazed / Ceramic Tiles / Vitrified Tiles in Flooring and Dado:
Page 124 of 171 124White Glazed Tiles from an approved manufacturer conforming to IS:777 shall be used. They shall be of specified size and thickness. All specials viz. coves, internal and external angles, corners, beads etc., shall be used wherever directed. Underlayer of specified thickness and mortar of stipulated proportion shall be laid as described in marble mosaic flooring. Tiles shall be washed clean and set in cement grout and each tile being gently tapped with a wooden mallet till it is properly bedded and in level with the adjoining tiles. The joints shall be kept as thin as possible and I straight lines or to suit the required pattern. After the tiles have been laid, surplus cement grout shall be cleaned off.
The joints shall be cleaned off the grey cement grout with a wire brush or trowel to a depth of 5 mm. (3/16”) and all dust and loose mortar removed. Joints shall then be flush pointed with white cement. The floor shall then be kept wet for seven days. After curing, the surface shall be washed with mild hydrochloric acid and clean water. The finished floor shall not sound not sound hollow when tapped with a wooden mallet.
PLASTERING
Scaffolding:
Scaffolding for carrying out plastering work shall be double steel scaffolding having two sets of vertical supports so that the scaffolding is independent of the walls.
Preparation of surface:
All putlog holes in brick work and junction between concrete and brick work shall be properly filled in advance.
Joints in brick work shall be racked about 10 mm. if not raked out while constructing brick masonry work and concrete surface hacked to provide the grip to the plaster, if not hacked earlier projecting burns of mortar formed due to gaps at joints in shuttering shall be removed.
The surface shall be scrubbed clean with wire brush / coir brush to removed dirt, dust etc., and the surface thoroughly washed with clean water to remove efflorescence, grease and oil etc., and shall be kept wet for a minimum of six hours before application of plaster.
Neeru Plaster:
Cement mortar of specified proportion and thickness shall be prepared in small batches and applied to the wall surface / ceiling. The ensure proper thickness, gauged patches shall be made at 1.5 to 2 m. apart and the surface plastered true to line, level and plumb taking special care to finish jambs of windows, doors, wall returns, corners, junctions etc. A thin layer of neeru shall then be applied and rubbed into surface and finished by means of trowel until the surface is even and smooth. The surface shall be kept moist for seven days and then given a coat of white wash.
Sand-faced Plaster:
The surface shall be prepared as above.
Page 125 of 171 125The coat of cement mortar in proportion of 1:4 or as specified, shall be applied uniformly all over the surface to a thickness of 12 mm. and finished true to level and line and keys shall formed on the surface. The surface shall be kept moist till the finishing coat is applied.
The finishing coat shall be applied a day or two after. The proportion of mortar for finishing coat shall be one part of cement and three parts of selected, well graded and washed sand, or as specified under item and it shall be applied in a uniform thickness of 6 mm. (1/4”).
The surface shall be tapped to uniform grained texture by using sponge pads as directed. Curing shall start after 24 hours and the surface kept wet for seven days.
Rough Cast Plaster:
Except for the finishing coat the surface shall be prepared and base coat of plaster applied as under sand-faced plaster.
Finishing coat mortar shall be in proportion of one part of cement and one part of specially selected and graded sand and one part of gravel of 3 to 6 mm. size. It shall be flung upon the first coat with large trowel to form an even and decorative coat. The work shall generally conform to clause 16.5 of IS:1661-1960. The thickness of the coat shall be about 12 mm. (1/2”). It shall be cured for seven days.
Rough coat plaster with colour finish:
This finish shall be similar to Rough cast plaster above except a high-grade mineral pigment of approved shade shall be mixed with white cement instead of ordinary grey cement while preparing the mortar.
Water-proofing Treatment :
Unless otherwise specified, the Contractor shall carry out waterproofing treatment of basements, terrace and water retaining structures through reputed firms having specialization in the line and approved by the Architects. The Contractor shall also furnish full details of such treatment to the Architects and provide all information / proof etc., regarding the effectiveness of the treatment when called upon to do so. All such treatment shall have to be guaranteed in the form approved by the Employer for a minimum period of ten years. Any defects / leakages noticed during the guarantee period shall have to be rectified free of cost by the Contractor including reinstating the surface to its original condition and finish.
Water-proofing of sunk portions of floor slabs for baths, W.C. and kitchen mories etc., in residential buildings, unless otherwise specified, shall be done as specified in the schedule and shall generally comprise of :
a) A coat of hot bitumen, min. 6 mm. thick screened with stone grit. b) Min. 20 mm. thick cement plaster in cement mortar 1:3 with approved water-proofing cement compound as per manufactures specifications. The plaster shall be cured by pounding for seven days.
The rate for the above treatment shall include drying and cleaning surfaces free of dust etc. and wiping with kerosene before application of bitumen. The vertical faces and returns shall also be treated similarly. The actual area treated including vertical faces and returns shall be measured and paid for. The work should be done in such a way that the finished flooring in bath has a minimum slope of 20 to 25 mm.
Page 126 of 171 126PAINTING
General:
Wherever scaffolding is necessary, it shall be double scaffolding.
The surface shall be thoroughly brushed free from mortar droppings and foreign matter. All steel work shall be cleaned of loose rust, mill scales etc. so as to expose the original surface. All broken edges, cracks, loose plaster and wavy surface shall be brought up either by patch plaster work or by plaster of paris.
All materials viz., dry distemper, oil bound distemper, oil paint, flat oil paint, synthetic enamel paint, plastic emulsion paint, cement primer, red lead and other primers and metallic paints shall conform to respective I.S.
specifications and shall be obtained from approved manufactures. All paints shall be brought on site in sealed thins in ready mixed form and shall be applied direct with the addition of thinner, if recommended by the manufacturers.
White Washing:
White was shall be prepared from lime slaked on spot, mixed and stirred with sufficient water to make a thin cream.
This shall be allowed to stand for 24 hours and shall be screened through clean cloth. Four kg. gum dissolved in hot water shall be added to each cubic meter of the cream (115 gm. per cft.).
Blue shall be added to give required whiteness. The approximate quantity of water to be added in making cream shall be five liters per kg. of lime.
White wash shall be applied in specified coats by using flat brushes or spray pumps. Each coat shall be allowed to dry before next coat is applied. If additional coats than what have been specified, are necessary to obtain uniform and smooth finish, it shall be given at no extra cost.
The finished dry surface shall not show any signs of cracking and peeling nor shall it come off readily on the hand when rubbed.
If directed by the Architects one coat of chalk and glue shall be applied before application of white / colour wash at no extra cost.
Colour Wash:
Colour wash shall be prepared by adding mineral colours not affected by lime to white wash. No colour wash shall be done until a sample of the colour wash to the required tint or shade has been got approved form the Architects.
Colour wash shall be applied as specified under white wash.
Dry Distemper:
Shade shall be got approved from the Architects before application of distemper.
Page 127 of 171 127The surface shall be prepared as specified earlier. A primer coat using approved primer or sizing shall be applied.
Distemper prepared as per manufacturer’s directions shall be applied and each coat shall be allowed to dry before subsequent coat is applied. The finished surface shall be free form chalking when rubbed, even uniform and shall show not brush marks. If additional coats are necessary, they shall be given at no extra cost.
Oil Bound Distemper:
The surface shall be prepared as specified above. A primer coat of either cement primer or any approved distemper primer shall be applied.
After the primer coat has dried, the surface shall be lightly sand papered and dusted to make to smooth to receive distemper.
Distemper shall be prepared as per the directions of the manufacturer and conforming to shade approved. It shall be applied in specified coats, taking care to allow for drying of each coat before subsequent coats are applied.
Water-proof Cement Paint / Sand-tex matt Paint:
The surface shall be prepared as specified above and thoroughly wetted with clean water before water-proof cement paint is applied.
The paint shall be prepared strictly as per manufacturers specifications and in such quantities as can be used up in an hour of its mixing, as otherwise the mixture will set and thicken, affecting flow and finish.
The paint thus prepared shall be applied on clean and wetted surface with brush or spraying machine. The solution shall be kept stirred during the period of application. It shall be applied on the surface which is on the shady side of the building so that the direct heat of the sun on the surface is avoided. The completed surface shall be watered after the days work. Number of coats shall be s specified in the item.
Painting – Oil / Enamel / Plastic Emulsion etc.:
Ready mixed oil paint, flat oil paint, plastic emulsion paint, ready mixed synthetic enamel paint, etc., shall be brought in original containers and in sealed tins. If for any reason thinner is necessary, the brand and quantity of thinner recommended by the manufacturer or as instructed by the Architect shall be used. The surface shall be prepared as specified above and a coat of approved primer shall be applied. After 24 hours drying approved or specified quality paint shall be applied evenly and smoothly. A filler putty coating may be given to give a smooth finish. Each coat shall be allowed to dry out thoroughly and then lightly rubbed down with sand paper and cleaned of dust before the next cost is applied. Number of coats shall be as specified in the item and if the finish of the surface is not uniform, additional coats as required shall be applied to get good and uniform finish at no extra cost.
After completion no hair marks from the brush or clogging of paint puddles in the corners of panels, angles or mouldings etc., shall be left on the work. The glass panes, floor etc. shall be cleaned of stains.
When the final coat is applied, if directed, the surface shall be rolled with a roller of if directed, it shall be stippled with a stippling brush.
POLISHING AND VARNISHING
French Polishing:
Page 128 of 171 128French spirit polish shall be of an approved make conforming to IS:348. If it has to be prepared on site, the polish shall be made by dissolving 0.7 kg. of best shellac in 4.5 liters of methylated spirit without heating. To obtain required shade pigment may be added and mixed.
Surface shall be cleaned. All unevenness shall be rubbed down smooth with sand paper and well dusted. Knots, if visible, shall be covered with a preparation of red lead and glue. Resinous or loose knots and gaps shall be filled with season timber pieces and make level with rest of the surface. Holes and indentations on surface shall be filled with putty made of whiting and linseed oil. Surface shall be give a coat of filler made of 2.25 kg. of whiting in 1.5 liter of methylated spirit. When it dries, surface shall again be rubbed down perfectly smooth with sand paper and wiped clean.
Piece of clean fine cotton cloth and cotton wool made into shape of pad shall be used to apply polish. The pad shall be moistened with polish and rubbed hard on the surface applying the polish sparingly but uniformly and completely over the entire surface. It shall have allowed to dry and another coat applied in the same way. To give finishing coat, the pad shall be covered with a fresh piece of clean fine cotton cloth, slightly damped with methylated spirit and fubbed lightly and quickly with a circular motion, till the finish surface attains uniform texture and high gloss.
Wax Polishing :
Wax polish shall either be prepared on site or obtained readymade from market. Polish made on the site shall be prepared from a mixture of pure bee’s wax, linseed oil, turpentine oil and varnish in the ratio of 2:1.5:1:½ by weight.
The bees wax and the boiled linseed oil shall be heated over a slow fire. When the wax is completely dissolved the mixture shall be cooled till it is just warm, and turpentine oil and varnish added to it in the required proportions and the entire mixture is well stirred.
Surface shall be prepared as described under French polishing except that the final rubbing shall be done with sand paper which has been slightly moistened with linseed oil.
Mixture or polish shall be applied evenly, with a clean cloth pad in such a way that no blank patches are left and rubbed continuously for half an hour. When the surface is quite dry a second coat shall be applied in the same manner and rubbed continuously for an hour or until the surface is dry. Final coat shall then be applied and rubbed for two hours or more if necessary, until the surface has assumed a uniform gloss and is quite dry showing no sign of sickness when touched. Gloss of the polish depends on the amount of rubbing, therefore rubbing must be continuous and with uniform pressure and frequent change in direction.
Varnishing :
Surface shall be prepared as described above. After preparation of surface, two coats of clean boiled linseed oil shall be applied at sufficient interval of time. After the linseed oil has dried two coats of varnish obtained from approved manufacturer shall be applied at sufficient interval of time. If the surface fails to produce the required gloss an additional coat shall be applied without any extra cost.
SPECIFICATIONS FOR SANITARY, PLUMBINGAND WATER SUPPLY INSTALLATION WORK I. SANITARY INSTALLATION:
Page 129 of 171 129SANITARY FIXTURES:
INDIAN TYPE W.C.PANS :
The W.C. pan shall be of White Vitreous China, of specified size and pattern. Pan shall be of approved quality and shall bear the mark of the firm manufacturing it. It shall have 10 cm. (4”) porcelain trap (“P” or “S” type with effective seal) and 5 cm. (2”) vent arm.
ORISSA TYPE PANS :
Shall be from an approved manufactures and traps as specified above.
FIXING :
Pan shall be fixed securely with a cushioning bed in an approved manner taking care that the cushion is uniform and even, without having any hollows between pan and the concrete. The joint between the pan the trap be made with cement mortar 1:1 and shall be leakproof.
Each closet shall be provided with the following accessories and the rate shall be all inclusive.
1) Necessary length of 10 cm.; H.C.I. pipe or lead pipe connecting the pan and plug bend. (The plug bend / tee connection to vertical stack shall be paid under appropriate item).
2) Wherever anti-syphonage pipe connections are required necessary length of lead pipe 6.25 cm. shall be
provided.
3) Flushing cistern shall be 10 litres capacity and cast-Iron overhead type with heavy G.I. Chain pull unless otherwise specified. If low down cistern is specified it shall be White Vitreous China cistern of best quality from an approved manufacturer with Chromium plated flush handle. The cistern shall have G.I. overflow pipe of length as per Municipal requirement or as per Architects drawing with mosquito-proof Brass screw cap and C.I. brackets with wall plugs and Brass union and couplings for flush pipe etc. complete unit.
4) 12 mm. PVC water inlet pipe with 12 mm. Brass stop cock.
5) The flush pipe from the cistern shall be of 32 mm. dia. telescopic G.I. pipe or lead pipe or as specified, which shall be connected to the W.C. pan by means of an approved type of joint.
6) Painting : All fittings and fixtures shall be painted with two coats of enamel paint over a coat of primer.
Or as described under item in Schedule of Quantity.
EUROPEAN TYPE W.C. :
The closet shall be of White Vitreous China readily flushed, of wash down type and shall be of best quality manufactured by an approved firm, and fixed to the floor by approved means, as described under item in Schedule of Quantity., Page 130 of 171 130Each closet shall be provided with the following accessories and the rate shall be all inclusive.
1) Seat : Heavy black plastic seat of approved quality and seat cover with rubber buffers fixed to the pan with C.P.
Brass bar hinge.
2) Cistern : Low level flushing tank 10 litres capacity of White Vitreous China cistern of best quality manufactured by an approved firm with C.P. flush handle and C.P. overflow pipe of length as per Municipal requirement or as per Architects drawing with mosquito-proof brass C.P. Cap etc., complete unit including enameled or C.P.
flush pipe and bend.
Or as described under item in Schedule of Quantity.
3) Necessary length of PVC water inlet pipe and 12 mm. dia. C.P. brass stop cock.
4) Necessary length of porcelain or lead or C.I. connecting pipe 10 cm. dia. (plug bend / tee connection to vertical stack shall be paid under appropriate item).
5) Wherever anti-syphonage pipe connections are required, necessary length of lead pipe 6.25 cm. dia. shall be
provided.
PAINTING :
All fittings and fixtures shall be painted with two coats of enamel paint over a coat of primer, externally.
LIPPED URINALS:
Shall be flat back or angle urinal of specified dimensions and shall be of White Vitreous China from an approved manufacturer.
They shall be screwed to the wall with coach screws of Chromium Plated Brass on dowel shaped wooden plugs built into the walls or fixed as per manufacturers specification. Each basin should have an outlet with C.P. Brass hinged grating connected to 40 mm. diameter waste pipe through a C.P. bottle trap. When a range of urinals are
provided only a straight length of 40 mm. diameter waste pipe and white glazed half round channel with tread platform finished with white glazed tiles complete as per Architects drawings shall be provided. All joints shall be in plumbers wiped solder joint with necessary C.P. Brass sockets and thimble etc.
STALL WALL TYPE URINALS :
Shall be White Vitreous China of approved design and manufacture.
They shall be fixed to the wall as per manufacturer’s specification. Each urinal should have an outlet with C.P. Brass hinged grating connected to 40 mm. diameter waste pipe through a C.P. Brass bottle trap. All joints shall be in plumber’s wiped solder joint with necessary C.P. Brass sockets and thimble etc.
FLUSHING CISTERN :
Page 131 of 171 131These shall be automatic flushing cistern of vitreous China or as specified in the Bill of Quantities complete with valve less syphon fittings. Cistern shall be supported on brackets of standard pattern and fixed to wooden dowel plugs embedded in the wall with C.P. Brass screws.
ANGLE VALVE :
The cistern shall be fed with 15 mm. (1/2”) C.P. Brass inlet tube angle valve of approved make with necessary length of lead inlet pipe complete with C.P. Brass unions unless otherwise specified in the Bill of Quantities.
The capacity of flushing cistern and size of the flush pipe for the number of urinals shall be as follows :
Capacity of flushing cisterns Mains Size of distribution Numbers of In Litres In Gallons In mm. In inches In mm. In inches Urinals 1 5 1 -- -- 15 1/2 2 10 2 20 3/4 15 1/2 3 10 2 25 1 15 1/2 4 15 3 32 1.25 15 1/2 The main and distribution pipe fittings and clamps shall be of C.P. Brass unless otherwise specified in the Bill of Quantities. Distribution pipes shall feed the urinals with C.P. brass spreaders of approved make.
PAINTING :
All brackets etc., shall be painted with two coats of enamel paint over a coat of primer.
LAVATORY BASINS:
They shall be of White Vitreous China of best quality manufactured by an approved make and size as specified in the Bill of Quantities. They shall be supported on a pair of C.I. brackets of approved design.
a) Fittings: Each lavatory basin shall be provided with a single cold water C.P. Brass pillar tap of approved design and make, C.P. Brass waste, C.P. Brass chain and rubber plug, C.P. Brass bottle trap of approved quality and design, with C.P. brass stop cock and PVC water inlet pipe of standard length 1/2” dia. complete.
b) Waste Pipe : Waste pipe beyond bottle trap shall be measured and paid separately under appropriate item.
Where specified, lavatory basins shall be provided with puff pipe with a brass perforated screws cap. c) Painting : All brackets, pipes etc. shall be painted with two coats enamel paint over a coat of primer.
SINKS :
They shall be of White Vitreous China or as specified in the Bill of Quantities with weir type overflow. The size of sink shall be as specified and shall be of approved make. They shall be supported on a pair of C.I. brackets of approved design.
Page 132 of 171 132a) Fittings : Each sink shall be provided with 40 mm. (1.5”) C.P. Brass waste of approved pattern with C.P. Brass chain and 40 mm. rubber plug and 40 mm. dia. C.P. Brass trap and union which shall be connected to 40 mm.
diameter waste pipe.
Waste pipe beyond the trap shall be measured separately and paid under appropriate item.
Where specified sinks shall be provided with puff pipe with a Brass perforated screw item. b) Painting : All fittings, brackets and pipes shall be painted with two coats of enamel paint over a coat of primer.
DRAINAGE BOARD :
Drainage boards of type and size as specified in the Bill of Quantities shall be provided. These shall be fixed on strong brackets of approved design and where necessary provided with hinges. Brackets shall be painted with two coats of enamel over a coat of primer.
III. TOILET REQUISITES :
MIRRORS :
Mirrors shall be of the best quality, specified size, approved design and make. It shall be mounted on plywood / particle board backing and shall be fixed in position by means of four C.P. Brass screws and cup washers over rubber washers on wooden plugs firmly embedded in the wall. Alternative method for fixing could be by using Brass clamps with C.P. Brass screws. A suitable T.W. cover mould of approved design shall be fixed all round as directed.
GLASS SHELF :
The shelf shall be of glass of approved quality and thickness with edges rounded off. The size of the shelf shall be as specified and shall rest on C.P. Brass brackets which shall be fixed with C.P. Brass screws to wooden plugs, firmly embedded in the wall. The shelf shall have C.P. Brass guard rail all round.
TOWEL RAIL :
Towel rail shall be of C.P. Brass with two C.P. Brass brackets. The size of the rail shall be as specified. The brackets shall be fixed by means of C.P. brass screws to wooden cleats firmly embedded in the wall. Where specified, Aluminum towel rails may be used of approved quality and design.
V. TECHNICAL SPECIFICATIONS FOR INTERIOR MATERIALS
SECTION – A - GENERAL This specification is for work to be done, item to be supplied and materials to be used in the works as shown and defined on the drawings and described herein, all under the supervision and to the satisfaction of the Competent Authority.
Competent authority means Architects / Engineer in charge.
Page 133 of 171
1331.1 The workmanship is to be the best and of high standard, use must be made of special trades men in all respects of the work and allowances must be made in the rates for doing so.
1.2 The materials and items to be provided by the contractor shall be approved by the Competent Authority in accordance with any samples which will be submitted for approval by Contractor and generally in accordance with the Specifications Also if products are specified in the catalogue reference, the contractor will be required to obtain the approval of the Competent Authority before using a material. The Contractor shall produce all invoices, vouchers or receipts for any material if called upon to do so by the Competent Authority.
1.3 Samples of all materials are to be submitted to the Competent Authority for approval before the Contractor orders or delivers the materials at site. Samples together with their packing are to be provided free of charge by the Contractor and should any materials be rejected, they will be removed from the site at the Contractor’s expense. All samples will be retained by the Competent Authority for comparison with materials, which will be delivered at the site. Also, the Contractor will be required to submit specimen finishes of colours, fabrics etc. for the approval of the Competent Authority before proceeding with the work.
1.4 The contractor shall be responsible for providing and maintaining and boxing or other temporary coverage required for the protection of dresses or finished work if left unprotected. He is also to clean out all shelving’s, out ends and other waste from all parts of the works before coverings or in-fillings are constructed.
1.5 Templates, boxes and moulds shall be accurately set out and rigidly constructed so as to remain accurate during they are in use.
1.6 All unexposed surface of timber e. g. false ceiling, backing fillets, backs of door frames, cupboard framing, grounds, etc. are to be treated with two coats of approved timber preservative before fixing or converging.
1.7 Only first-class workmanship will be accepted. Contractor shall maintain uniform quality and consistency in workmanship throughout.
2. JOINERY:
2.1 Joinery is to be prepared immediately after the placing of the contract, framed up, bonded and waged up. Any portions that are wrapped or found with other defects are to be replaced before wedging up. The whole of the work is to be framed and finished in a workmen-like manner in accordance with the detailed drawings wrought and wherever required, fitted with all necessary metal ties, straps, belts, screws, glue etc. Running beaded joints are to be cross-tongued with teak wherever 1½ thick double cross tongued. Joiners work generally to be finished with fine sand/glass paper.
2.2 Joints: All joints shall be standard mortise and tenon, dowel, dovetail, and cross-halved. Nailed or glued butt joints will not be permitted, screws, nails etc. will be standard iron or wire of oxidized nettle fold tenon should fit the mortises exactly.
2.3 Nailed or glued butt joints will not be permitted except in exceptional cases with approval of Competent Authority.
Page 134 of 171
1342.4 Where screws shown on a finished surface, those will be sunk and the whole plugged with a wood plug of the same wood and grain of the finished surfaces will be neatly punched and the hole filled with wood filler to match the colour.
2.5 Should joints in joiner’s work open, or other defects arise within the period stated for defect liability in the contract and the clause thereof, be deemed by the Competent Authority to be due such defective joinery shall be taken down, and refilled, redecorated and/or replaced if necessary and any work disturbed shall be made good at the Contractor’s expense.
2.6 Nails spikes and bolts shall be of lengths and weights approved by the Competent Authority. Nails shall comply with is 1959-1960 approved quality sample. Brass-headed nails are to comply with B. S. 1210. Wire staples shall comply with B. S. 1494.
2.7 The contact surface of dowels, tennons wedges etc., shall be glued with an approved adhesive. Where glued, joinery and carpentry works are likely to come into contact with moisture, the glue shall be waterproof.
3.0 HARDWARE AND METALS:
The hardware throughout shall be of approved manufacture or supplier well-made and equal to in every respect to the samples to be deposited with the Competent Authority. The contractor may be required to produce and provide samples from many different sources before the Competent Authority takes decision and he should allow his rates for doing so.
3.1 Fittings generally shall be brass oxidized, unless otherwise specified and shall be suitable for their intended purpose. In any case, it will have to be approved by Competent Authority before the Contractor procures it at site of work.
3.2 Screws are to match the finish of the article to be fixed, and to be round or flat headed or counter sunk as required.
3.3 The contractor should cover up and protect the brass and bronze surfaces with a thick grease or other suitable productive material, renew as necessary and subsequently clean off away on connection.
3.4 Aluminum and stainless steel shall be of approved manufacture and suitable for its particular application.
Generally, the surface of aluminium shall have an anodized finish and both shall comply with the samples approved by the Competent Authority. All stainless-steel sheets shall be 304 S. S. Japan with gauge as specified but not thinner than 16G.
3.5 All steel, brass, bronze, aluminium and stainless-steel articles shall be subjected to a reasonable test at the Contractor’s expense.
3.6 ll brazing and welds are to be executed in a clean and smooth manner rubbed down and left in the flattest and tidiest way, particularly where exposed.
3.7 Chromium plating shall be in accordance with I. S. Standard or as per approved specification for normal outdoor conditions and shall be on a base material of copper or brass.
Page 135 of 171
1354.0 GLAZIER:
4.1 All glass to be of approved manufacturer complying with IS 3548-1966 as per approved quality and sample to be of the selective qualities specified and free from bubbles, smoke, air holes and other defects.
4.2 Polished plate glass shall be “glazing glass” (G. G.) quality and that for mirrors shall be “silvering quality” (S.G.) conforming to IS 3438-1965 or as per approved sample and quality.
4.3 The compound for glazing to metal is to be a special non-hardening compound manufactured for the purpose and of a brand and quality approved by the Competent Authority.
4.4 While cutting glass, proper allowance be made for expansion. Each square of glazing to be in one whole sheet.
On completion of work clean all glass inside and cut, replace all cracked scratched and broken panes and leave in good condition.
5.0 PAINT AND POLISHES:
5.1 All material required for the works shall be of specified and approved manufacturer, delivered to the site in the manufacturer’s container’s name or trade mark with a description of the contents and colour. All materials are to be stored on the site.
5.2 Spray painting with approved machines will be permitted only if written approval has been obtained from the Competent Authority prior to painting. No spraying will be permitted in the case of priming costs nor where the soiling of adjacent surfaces is likely to occur. The buzzle and pressure to be so operated as to give an even coating throughout to the satisfaction of the Competent Authority. The paint used for spraying is to comply generally with the specification concerned and is to be specially prepared by the manufacturer for spraying.
Thinning of paint made for brushing will not be allowed.
5.3 Wood preservative shall be Solignum or other equal and approved impregnating wood preservative and all concealed woodwork shall be treated with wood preservative.
5.4 All brushes, tools, pots kettles etc. used in carrying out the work shall be clean and free from foreign matter and are to be thoroughly cleaned out before being used with a different type of class of materials.
5.5 All iron or steel surfaces shall be thoroughly scraped and rubbed with wire brushes and shall be entirely free from rust, mill scale etc. before applying the priming coat.
5.6 Surfaces of now wood work which to be painted are to be rubbed down, cleaned, down to the approval of the Competent Authority.
5.7 Surfaces of previously painted woodwork which are to be painted are to be cleaned down with soap and water, detergent solution or approved solvent to remove dirt, grease etc. Whilst wet the surfaces shall be flatted down with a suitable abrasive and then rinsed down and allowed to dry. Minor areas of defective paint shall be removed by scraping back to a firm edge and the exposed surface touched in with primer as described and Page 136 of 171 136soaked with putty. Where woodwork has been previously painted or polished and it is to be newly polished, with scrapping, burning off or rubbing down and making surface properly.
5.8 Surfaces of previously painted metal which shall be painted are to be cleaned down and flattened down as described in surfaces of any rust and loose scale shall be removed completely by chipping, scrapping and wire brushing back to the bare metal and touched in with primer as described.
5.0 UPHOLSTERY:
5.1 This will be of first class standard workmanship with webbing, no-sag springs, coiled springs, padding and filling as specified on drawing. Covering fabrics will be seen, tufted, and corded as shown on the drawing and as approved by the Competent Authority.
5.2 Cushion Vents: Brass “cushion Vents” should be installed at the back or under side or seat cushions (especially those covered in leather vinyl plastic or very tightly woven fabric) to allow air to escape easily and to prevent torn seems.
5.3 Materials: Finished timber shall be of the type specified. Furnishing fabrics, colour, pattern, substance to be as specified, no variations of this will be permitted unless with prior approval of the Competent Authority.
6.0 POLISH:
6.1 French polish: The basic material shall be shellac dissolved in mentholated spirit.
Preparation:
The timber must be well sanded and cleaned and the grain filled with grain filler. Any staining must be done before applying the polish.
Equipment:
The polishing rubber the most important implement in French polish shall consist of a pad of cotton wool, which acts as a reservoir for the polish, and a cover of soft white linen of cotton fabric, similar to a well-worn handkerchief which acts as a fitter. The rubber must never be dipped into the polish; it should be charged by pouring the polish on to the pad with the cover removed.
Application:
Work evenly over the surface with a slow figure-of-eight motion until the timber is coated with a thin layer of polish. The object is to apply a series of thin coats, allowing only a few minutes for drying between the coats.
When a level and even-bodied surface is obtained the work is ready for the second stage i.e. spiriting off.
Allow the work to stand for at least eight hours, then take a fresh rubber with a double thickness of cover material and charge it with mentholated spirit. The object of spiriting off into and remove the rubber marks and to give the brilliance of finish.
Finally, work in the direction of the grain and continue until the surface is free from smears and rubber marks then leave to harden off.
Page 137 of 171
1377.1 Wax polish:
Wax polish shall contain silicones and driers. A good silicon wax is to be used not a creamy or spray. The timber shall be sealed first with another finish such as Ron seal, before applying wax.
Application:
Apply coat of the sealer by brush or cloth direct to the unfilled timber, working it well in and finishing evenly with the grain. Allow to dry thoroughly then sand lightly with fine abrasive paper. Apply a heavy coat of wax by cloth on flat surfaces, with a stiff brush. Work it well into the timber and finish off by stroking with the grain before leaving to harden. Leave for four hours before rubbing up with a soft brush. Finally, buff the grain with a soft cloth.
7.2 Transparent Coloured Polyurethane (Melamine) This shall be applied where natural grain of the wood is required to show. Polyurethane gives tough surface which resist chipping, scratching and boiling water.
Application:
Clean off all grease and wax with an abrasive and white spirit, this should not be applied in humid conditions.
Apply the first coat, preferably of clear hard glaze with a cloth pad. Leave this to dry for at least six hours, then apply further coats with a paintbrush. If you wait for longer than 24 hours between coats, rub down the previous coat with fine glass paper or a medium grade of steel wool. Obtain a matt finish, if required, by giving a final coat of clear Reseal Matt coat.
8.0 TIMBER:
8.1 Only seasoned Teakwood to be used unless otherwise specified.
8.2 Use of Rose wood wherever specified.
8.3 All the wood shall be properly seasoned, natural growth and shall be free from worm holes, loose or dead knots or other defects, saw die square and shall not suffer warping, splitting or other defects.
8.4 The moisture content shall not exceed 12%.
8.5 All internal frame work shall be treated with approved wood preservative.
8.6 All wood brought to site should be clean shall not have any preservative or other coating/covering.
8.7 All rejected decayed, bad quality wood shall be immediately removed from site.
8.8 All wood brought to site must be stacked-stored properly as per instructions.
9.0 PLYWOOD:
9.1 Plywood/medium density fibre board/teak practical board/ Veneer shall be as specified in the approved list of manufacturers shall be used.
9.2 Commercial ply shall confirm IS-303 of approved make.
9.3 Marine plywood shall generally conform to generally IS-303 BWR or unless specified IS-710-1980(BWP).
9.4 Particle board shall be phenol formaldehyde bonded and generally conform to IS 3087-1965.
Page 138 of 171
1389.5 Only 3mm to 4mm thick straight-grained groups matching approved veneers shall be used. No extra claim will be entertained for veneer if found of extra thickness.
LIST OF APPROVED MATERIAL AND MAKES OF ITEMS
1. CEMENT (Any Grade) : ULTRATECH, AMBUJA, ACC, JK, BIRLA
WHITE CEMENT : BIRLA WHITE, J.K WHITE
2. STEEL FOR REINFORCEMENT : TATA, SAIL, JINDAL/JSW
3. BRICKS : JINDAL, GHOLE BRICKS OF METRICSYSTEM, BHARAT
4. WOOD : FIRST CLASS C.P. TEAK UNLESS OTHER WISE SPECIFIED.
SOFT WOOD : KAIL WOOD, HOLLOCK
5. BITUMIN : STP OR ANY OTHER I.S.I. MARKED BRAND
6. ALUMINUM SECTION : HINDALCO, INDAL OR JINDAL
7. EXTERNAL PUTTY : BIRLA WALL CARE
8. EXTERNAL PAINTS : ASIAN, BERGER, NEROLAC, ICI
9. STEEL PRIMER : ASIAN, BERGER, ICI
10. SYNTHETIC ENAMEL PAINT : APCOLITE, NEROLAC, DULUX, ICI
11. CEMENT PAINTS FOR EXTERIOR : SNOWCEM PLUS, SUPER FINISH INDOCEM, ICI, 12 WATER PROOFING COMPOUND : SUNANDA, SIKA, ROFF, FOSROC KRISHNA CONCHEM, BASF.
13. BUTT HINGES : GODREJ, KICH, HETTICH & ISI MAKES
14. FACTORY MADE SHUTTERS : ARCHID, ROYALE TOUCH, CENTURY, (ANY DOOR) ANCHOR, GREEN.
15. PVC DOOR SHUTTERS : SINTEX, SPLENDOOR, GODREJ
16. GALVANISED STEEL SHEETS : TATA, JINDAL, HINDALCO
17. GALVALUMN SHEETS : TRAC, KIRBY, CRIL Page 139 of 171
13918. C.I. PIPES AND FITTINGS : B.I.C., HEPCO, NECO
19. G.I. PIPES : G.S.I. AMBICA, ZENITH, TATA
20. BRASS C.P. FITTINGS : PLUMBER, L&K, JINDAL, TECHNO
21. GUN METAL VALVES : LEADER, SANT OR EQUIVALENT
22. E.W.C., O.W.C., PANS : AMERICAN STANDARDS, GROHE, KOHLER, TOTO, QUEO.
WASH BASINS, URINALS AMERICAN STANDARDS, GROHE, KOHLER, TOTO, QUEO.
23. E.W.C. SEATS : SAME AS EWC BRAND
24. FLUSHING SYSTEM : SAME AS EWC BRAND
25. WATER METER : ANAND, ASAHI, KAYCEL, KAPSTAN
26. ASBESTOS CEMENT PIPES AND : LOCALY AVAILABLE APPROVED MAKE FITTINGS
27. PIGMENTS : TATA, SHALIMAR
28. PVC PIPES, uPVC : PRINCE, SUPREME, FINOLEX, ASHIRVAD
29. CPVC PIPES : PRINCE, SUPREME, FINOLEX, ASTRAL ASHIRVAD
30. FIRE FITTING SLUICE & NRV : KIRLOSKAR / KALPANA
31. CEMENT BOARDS / CALCIUM : BISON BOARDS. NUWUD, HILUX SILICATE BOARD
32. MORTICE LOCK, HANDLE : GODREJ, KICH, HETTICH, HAFELE HARDWARE OF ANY / ALL TYPES
33. DOOR CLOSERS, FLOOR SPRINGS: DORMA, HETTICH
34. FLOORING TILES : KAJARIA, JOHNSON, NITCO RAK
35. M.S / BRASS SCREWS : NATTLE FOLD
36. MILD STEEL FOR FABRICATION : TATA, SAIL
37. FLUSH DOOR SHUTTERS : ARCHID, ROYALE TOUCH, CENTURY, ANCHOR, GREEN.
Page 140 of 171 140NOTE:- a) The contractor shall produce samples before procurement of the material for approval of the Employer for all materials required for works. Samples can be submitted from any of the above makes and they shall conform to specifications. Samples as approved by the Employer shall only be used on the works and the decisions of the Employer regarding sample shall be final.
b) In respect of materials for which approved makes are not specified as above, the same shall be decided by Employer and shall be as per sample got approved from Employer before procurement. c) The contractor shall submit samples of all materials three months before the date of work for approval from the Employer.
d) In case if the makes are mentioned in the BOQ specifications, in that case the said makes as indicated in the BOQ shall prevail upon the makes indicated herein-above and the preference would be given to the BOQ makes and in case if unavailable, only then any make out of the makes of the items mentioned herein-above would be adopted by the contractor, however with the prior approval of the PFRDA and the Architect.
LIST OF RECOMMENDED MATERIALS – INTERIOR & CIVIL WORKS S. No Material / Product Approved Brand / Manufacturers
1. Commercial / Marine Plywood B.W.P (710) / B.W.R Grade phenol Bonded Anchor, Century, Everest Ply, Archid Ply, Green Ply
2. Particle Board & MDF Kenwood, Euro Board, ASIS Industries, (Exterior Grade Archid Ply (Plain & Pre-veneered), Associate Eco Friendly, Wood free) Board, Action TESA, Duro, Green
3. Veneers (Natural) Duro, Green, Century
4. Laminates Royal Touch, Samrat, Greenlam, Century
5. Hardware, Fittings Kich, Dorma, Hettich, Hafele India, Godrej & Fixtures of any type
6. Adhesive For wood - Fevicol For Stainless Steel, Brass, Glass - Araldite
7. Paints of all types Asian Paint, I.C.I. (Deluxe), Nerolac, Berger
8. Door Closers Dorma, Kich, Hettich, Hafele India, Godrej Floor Springs, Patch fittings Page 141 of 171
1419. Locks Dorma, Kich, Hettich, Hafele India, Godrej.
10. Wood Preservatives Asian, Bison - British Paints, ICI
11. Pest Control PCI, Godrej, Rentokil PCI
12. Teak Wood Best quality teak, Well-seasoned, free from sap, Knots, cracks, Uniform in colour.
13. Glass & Structural Saint Gobain, AIS, PILKINGTON Glazing / Elevational Glazing Saint Gobain, AIS MODI Guard (Modi Guard to be used only for Or Glass for Internal / Exterior Glazing Interior Glazing requirements)
14. PVC Flooring Premier Vinyl, Krishna Vinyl, Stilex Flooring
15. Gypsum Board India Gypsum Ltd, Gyproc,
16. Mineral Fibre ceiling Saint Gobain, Armstrong, AMF
17. Venetian Blinds / Roller Hunter Douglas, Vista Levelor, MAC Blinds
18. (a) Chairs of all types Durian, Stanley, Amber, Herman Miller (Only with the Prior approval of Architect / Engineer in charge) 18 (b) Sofas Stanley, Durian, Amber (Only with the Prior approval of Architect / Engineer in charge)
19. Tile adhesives BASF, Roff, Sunanda Specialty Coatings Pvt. Ltd, Krichna, SIKA
20. Ceramic & Vitrified tiles RAK, Johnson, Kajaria, NITCO
21. Plumbing fixtures-Accessories Jaguar, Marc, KEUCO, Hindware (Executive type – Italian Collection), BRAVAT
22. Aluminium Sections/Fittings Jindal, Hindalco, Indal, Bharat
23. ACP (Aluminium Composite Alcobond, AluK-Bond, Alstrong Panels-Exterior & Interior Alu Décor, Eurobond
24. Special Fittings Dorma, Kich, Hettich, Hafele India.
Page 142 of 171
14225. All Repair Work chemicals BASF, Sunanda Specialty Coatings Pvt Ltd, Krishna, SIKA.
26. Flush Doors & Fire Doors Metal Doors – Godrej, Shakti& Non metal Fire doors- Royale Touch, Green, Wedge India Wooden Fire Doors –Royal Touch, Green, Century
27. Fire resistant Board Bison Board of Bison. HILUX, Promatec
28. Calcium Silicate board Hilux, Promatec, Ramco
29. Insulation Materials Rockwool, TWIGA
30. Compactors / Slotted Angle Racks Balas, Godrej, Steelage
31. Signages of all types 3M, Llumar.
32. Sun Control Film & Reflective films 3M, Llumar, Garware
33. Glazing Sealants DOW Corning, GE Sealant
34. PVC Pipes & fittings Finolex, Prince, Supreme, Astral
35. Wooden Flooring Square Foot, Finsa, Pergo, Xylos, Armstrong, Royale Touche
36. SS Railing Kich, Hettich, Dorma kaba
37. Textured Paint Oikos, Asian Specialty Textures
38. Keyboards Trays, CPU Trolleys & Pop up Boxes etc Ebco, Hettich, Innofitt
39. Teflon / Tensile Fabric / Membranes Unique Aesthetics Pvt Ltd, Mansi Membranes.
40. Acrylic Solid surfaces Corian, Alu décor Granium
41. External Pavers / Flooring Pavit Ceramic Pvt Ltd, Shakti
42. Translucent Panels / Cut Panels/ EDGE, Translucent Methacrylate sheet – Paneling EDGE CREO, EDGE ARTECH Panels or equivalent approved & (With/Without backlit arrangements) Acryllic Solid surfaces – Page 143 of 171 143Neonnex
43. MDF Designer boards EDGE Deco Plus, Re-Invent
44. Wallpaper Marshal, Ego Wall Décor.
45. White Board, Magnetic Board ALL ARK, Kings India.
46. Polycarbonate Sheet Lexan, Tuflite, Spanko.
47. Cement Paint Snowcem, Surfacem, Durocem.
Any additional item as per BOQ specifications or as per the instructions of the PFRDA / Consultants. Any of the above items / other items if any will be as approved by the Consultants & Engineer-in-charge.
In case if the makes are mentioned in the BOQ specifications, in that case the said makes as indicated in the BOQ shall prevail upon the makes indicated herein-above and the preference would be given to the BOQ makes and in case if unavailable, only then any make out of the makes of the items mentioned herein-above would be adopted by the contractor, however with the prior approval of the PFRDA and the Architect.
Page 144 of 171 144TECHNICAL SPECIFICATION A - GENERAL SPECIFICATION FOR ELECTRICAL INSTALLATION
Complete Installation will be done complying with the requirements of the followings: a) Indian Electricity Act, 1910. b) Indian Electricity Rules (1956) amended upto date. c) Code of practice for Electrical wiring installations (system voltage not exceeding 650v) IS 732- 1963 Revised d) Code of practice for Electrical wiring installations (system voltage exceeding 650v) IS 2274-
1963. e) Rules and Regulations, Regional Council of Fire Insurance Association of India for Electrical wiring.
RULES AND REGULATION ISI SPECIFICATIONS I.S. NO I.S. TITLE MATERIAL EQUIPMENTS 694 PVC Insulated Cables PVC Cables 1293/3854 Switch socket outlet 5A/15A/Switch sockets.
3043 Code of practice for earthing. Earthing.
3646 Interior illumination Luminaries/Fittings.
5216 Guide for safety of installation Procedure & practices.
1248 Electrical Indicating Instrument.
1534 Ballast for fluorescent Luminaries. Tubes.
1653/266 P.V.C. conduit 2667/3837 Code of practice for electrical wiring installation Wiring 371 Ceiling Roses Luminaries 1567 Metal clad switches.
2268 Electric call bells/Buzzers Call bells.
37A Fans & Regulators Fans Page 145 of 171 145I.S. NO I.S. TITLE MATERIAL EQUIPMENTS 1169 Fans & Regulators Pedestal type 2312 Exhaust Fans Exhaust fans 1947 Illumination Flood lights 418 Electric lamp GLS Lamps.
2412 Tubular Fluorescent lamps Tube lights 3854 Switch for domestic & Similar purpose. Switch.
1293 3 pin plug socket outlet Socket.
3106 For selection, installation and maint. elect. fuses.
5908 For methods of measurements of electrical installations.
1 Earthing :
1.1 16 SWG bare copper conductor or 1.5 sq.mm. pvc insulated (1.1KV) grade Cu. wire shall be
provided as earthing for all light fittings from local control box to individual fittings through the conduits and junction boxes.
1.2 14 SWG bare copper conductor or 1.5 sq.mm. pvc insulated (1.1KV) grade Cu. wire shall be
provided as earthing for socket outlets of 5/15A/20A.
1.3 The flexible metallic tubing is not a reliable earth continuity conductor and hence will not be used for earthing.
2. POINT WIRING :
2.1 Point wiring shall be in PVC conduits (heavy gauge) as mentioned in Bill of Quantity. It shall be on surface in case of false ceiling and false wall, and concealed in absence of false walls, false ceilings.
2.2 The wiring throughout the installations shall be such that there is no break in the neutral wire, in the form of a Switch or Fuse Unit.
2.3 All runs of wiring and the exact positions of all points shall be according to the layout or the specifications given by the Consultant and in the absence of same, the Contractor shall mark the same on the plan and approve it from the Consultant/ Site Engineer before actual commencement of work.
2.4. In any system of wiring no bare or twist joints shall be made at intermediate points in the run of cables unless the length of Final sub-circuit, sub-main or main is more than the length of standard coil as given by the manufacturer of the cable. If any jointing becomes unavoidable such joint shall be made through proper cut-outs or through proper junction boxes open to easy inspections.
1462.5 Where 4 wire 3 phase wiring is done the neutral shall be in one color and the other three wires in another colour.(R,Y,B)
3. DEFINITION :- Wiring from local switch board through control switches shall be considered as one point. Wiring from the first fitting to the next fitting in the same circuit shall be considered as half point, or as group of two /three / four / five/ six etc.
The number of points shall generally be measured as under:
3.1 From individual control switch to first light/fan fitting shall be one point subsequent fitting in the same circuit shall be considered as given above & Bill Of Quantity.
3.2 If a socket outlet is tapped from the same lighting circuit it shall be treated as half point.
3.3 If a separate circuit is used for a socket outlet it will be considered as one point.
4. Each point wiring shall comprise the following :
4.1 Supply and installation of 20/25 mm PVC with accessories such as bends, inspection tees, elbows, two ways, 3 ways, 4 ways, junction box etc.
4.2 Supply and pulling of wires from the local board to single various points.
4.3 Supply and fixing of control switch boards, switches, socket outlets, lamp holders etc. for individual points.
4.4 Supply and Installation of multiway enclosed PVC junction boxes and 3 way/10 Amps. terminal blocks for light and fan fitting.
4.5 Supply and fitting/fixing of hardware such as clamps, saddles, screws, bolts, nuts, frame work as required.
4.6 Supply, laying and termination of earthing conductors for socket outlets, fittings and installations etc.
5. WIRES & CABLES :- Colour Identification of Cores of Non-flexible cables and Bare Conductors for Fixed Wiring.
Function Colour Identification of core of rubber or p.v.c.
Insulated non-flexible cable, or of sleeve or disc to be applied to conductor or cable core.
Earthing Green-and-Yellow or Green Live of a.c. single or three-phase Circuit Phase R of 3-phase a.c. Circuit Red Phase Y of 3-phase a.c. Circuit. Yellow.
Phase B of 3-phase a.c. Circuit. Blue Positive of d.c.2-wire Circuit Red 147Negative of d.c. 2-wire Circuit Black
6. All the conductors of the wires/cables shall be of copper unless/otherwise mentioned.
6.1 Single core armoured cable shall not be used any where.
6.2 1.5 sq. mm. (3/0.8 mm) P.V.C. insulated wires 1.1 KV grade shall be used upto maximum load current of 3A Amps.
6.3 2.5 sqmm (3/1.04 mm) P.V.C. insulated wires 1.1 KV grade shall be used upto maximum load current of 10 Amps.
6.4 4 sq.mm. ( 7/0.85 mm) P.V.C. insulated wires 1.1 KV grade shall be used upto maximum load current of 20 Amps
6.5 Wires and cables of the sizes including and above 4 mm**2 for aluminium and 7/.036 SWG for copper will be terminated; copper solder less crimped sockets and copper soldered sockets respectively.
6.6 Looping of conductors and tee-joints in power wiring shall not be employed. Power and heating sub-circuits shall be kept separate and distinct from fan and lighting sub-circuits.
7. CONDUIT INSTALLATION :-
7.1 PVC conduit system shall be mechanically and electrically continuous across joints.
7.2 Conduit installation shall be of surface type in case of False ceiling or false walls and shall be of concealed type in absence of false wall or false ceiling.
7.3 In case of false wall/ceiling where sufficient space or false covering is not available the conduits are to be concealed.
7.4 All conduit pipes shall be confirming to I.S: 1653
7.5 The routing of conduits shall be marked on ceiling, walls or structures in accordance with the drawings; as per layout approved by the Consultant. The installation shall be undertaken after approval of the same by Consultant. Any changes suggested by the Consultant shall be followed by the Contractor.
7.6 All bare threaded portions shall be treated with anticorrosive preservative or covered with approved plastic compound.
7.7 The conduit shall be of 16 gauge or MMS upto 25 mm dia and 14 gauge or HMS above 32 mm dia, reputed and approved make conforming to IS specification.
7.8 Conduits shall be supported on walls, ceiling or structure by means of distance saddles at a spacing not exceeding 1.75 M horizontally and 2.0 metre vertically for conduits of 20 mm size.
7.9 All conduits shall however be supported within a distance of 225 mm at either end of junction boxes, lighting fittings, switches or equipment enclosures. In case of right angle bends and offsets, conduits shall be supported within 150 mm at either end. The distance saddle shall maintain a minimum clearance of 3 mm. between the conduits and the surface on which conduit is being installed.
1487.10 Inspection boxes, elbows or tees shall be used as specified or specifically approved by the Consultant. Solid bends shall be provided as far as possible.
7.11 All conduits installation shall be carried out accurately and neatly. All conduit runs shall be truly horizontally or vertically, threading of conduits shall be done to close tolerance.
7.12 When conduits are to be concealed the conduit pipes shall be firmly tied to the steel reinforcement with steel wires at intervals not greater than 1 meter and on both sides of accessories like junction boxes, beds, coupling etc.
7.13 For concealed conduits uses of Tees, elbows and sharp bends shall be avoided as far as possible. And no length of conduit shall have more than two bends from outlet to outlet. (Use 2-way/3- way Junction Box if possible)
7.14 All conduit runs shall be thoroughly cleaned of dust, moisture etc. by blowing compressed air or by any other suitable means.
8. CONDUIT WIRING :- i) The No. of wires to be drawn through conduit shall be as given in the below table.
CONDUCTOR OF CABLE Nominal SIZE OF CONDUIT (mm) cross Number and sectorial area dia in mm area mm**2 of wires 20 25 30
1.0 1/1.12 5 10 14
1.25 3/0.75 5 10 14
1.5 1/1.40 5 10 14
2.0 3/0.925 4 8 12
2.5 1/1.80 5 8 12
3.0 7/.75 4 6 10
4.0 1/2.24 3 6 10 ii) Conduit wiring shall generally be carried out with single core P.V.C. insulated wire. iii) The conduit installation with Tie wire shall be complete in all respects before the cables are drawn in conduits.
iv) An approved unbricating compound (such as soap, stone powder, flakes or talc) shall be applied to the insulated wires before they are drawn in conduits. The wire shall be neatly bunched together to prevent twisting or kinks.
v) The number of wires run in one conduit shall be such that it permits easy drawing in of wires. vi) The wires passing through the conduits shall be of opposite polarity or conductors of opposite polarity should be bunched together.
9. CONCEALED CONDUIT WIRING:-
9.1 Concealed point wiring shall be provided through 20/25 mm dia. Conduits concealed 1" to
1.5" deep inside the walls, beams, columns, slabs etc.
9.2 The control boxes and distribution boxes shall be flush type concealed deep in the wall with only operating switch levers emerging out on the wall.
1499.3 All the control boards shall be at an height of 1500 mm. from floor level ( or refer HT. mentioned in drawings.).
9.4 Chipping and digging walls, beams, columns, slabs etc. for concealing conduits and replastering with necessary material to form even surface will be under Contractors scope of work.
10. INSTALLATION OF CABLES :-
10.1. All the cables shall be conforming to IS 1554, with PVC insulation, PVC sheathed, 1100V grade steel armoured with stranded copper/Aluminum conductors.
10.2 Cable supplied shall be of reputed make having ISI mark.
10.3 No cable joints are allowed, unless it is absolutely essential and will be carried out only after.
10.4 The cable shall be tied with Nylon ties at regular intervals of 1 meter for horizontal length.
In case of vertical run cable shall be tied at every 500 mm width with metallic cable ties. At the cable bend ties shall be provided at 150 mm interval from the centre of bending radius to avoid any sharp bends.
10.5 Cable entry and exit of distribution boards shall be done by appropriate glands and lock- nuts.
10.6 All cables shall be terminated with crimped soldered copper lugs of proper sizes.
10.7 Armouring of cables shall be terminated at earthing stud provided on each distribution boards.
10.8 The cable to be laid in the ground shall be laid at 750 mm depth from ground level and sandbed of 75 mm shall be provided. Width of trench will be approved by Corporation/Consultant depending upon no. of cables to be laid. Bricks are to be laid on the cables and then the back filling with screened soil.
10.9 Trench excavation, supply of sand bricks back filling and all associated necessary work and supply of material for same shall form Contractor's scope of work.
10.10 For cables laid in the ground, cable markers are to be provided on the cable route at every bend at every 15 metres for straight run.
10.11 The cables crossing through floors, walls etc. should be through G.I. pipe and sealed with fire barrier material and bushes.
10.12 Where groups of H.V., L.V. control and telephone cables are to be laid along the same route suitable barriers to segregate them physically shall be employed.
10.13 The communication cable shall be at least 300 mm away from power cable.
15011 CABLE TERMINATION :-
11.1 P.V.C. insulated steel armoured 1100 V Grade cables are to be terminated with help of Siemens glands for larger size cables and flange type glands (brass) for 2.5 mm**2 cables.
Crimping type copper lugs are to be used for end terminations. All standard practices to be followed and anti corrosive inhibiting flux is to be used. Brass nuts bolts with plain and spring washers are to be used.
11.2 Any accessories other than above such as cable and box, jumpers etc. for cable terminations shall be included in the scope of termination of cables.
11.3 Spliced ends of cable shall be immediately crimped with lugs. Base conductor shall not be left open to atmosphere.
11.4 All the strands of a conductor must be fitted in the lugs and no cutting of strands will be allowed under any circumstances.
11.5 He appropriate size of holes shall be drilled on the cable gland plate so that the gland after lightening is firmly secured with the gland plate. Any additional holes in the gland plate shall be plugged to make it vermin proof.
12 SOCKET OUTLETS & PLUGS:- i) The socket shall be so wired that the phase or the line is connected to one of the pins through the switch controlling the socket and not directly. ii) Three pin socket outlets of 5A shall be earthed with 16 SWG bare copper conductor or 1.5 sq.mm. pvc insulated wire (1.1 KV grade ).
iii) Three pin socket outlets of 15/20A shall be earthed with 14 SWG bare copper conduct or
2.5 sq.mm. pvc insulated wire( 1.1 KV grade). iv) 20 A socket outlet shall be industrial type (MDS-make) with provision of circuit breaker. v) The isolated socket outlets shall be installed at distance mentioned in layout or as specified by the Consultant. However, the socket outlet shall be installed at a distance not less than 23 cms. from the floor level and shall be away from danger of mechanical injury.
vi) A socket outlet shall not embody fuse terminals as an integral part of it but the fuse may be embodied in plug. vii) Every plug containing a fuse shall be non-reversible and shall be pulled through separate conduit system (not to be mixed with light, fan point etc.) 13 SWITCHES 151i) Quick make and break switches shall be used.
ii) All single pole switches shall be fitted in phase or line conductor. iii) Termination of wires at switches or plug points shall be carried out by looping the conductor at end instead of straight strand connection.
iv) The Switches for various appliances etc. on the boards shall be marked as according to the numbers mentioned in the single line wiring diagram.
B - LIGHTING FIXTURE SCHEDULE 1 LUMINARIES
1.1 All light fittings are to be provided with lamps/tubes.
1.2 Luminaries are to be as per the makes and catalogues indicated.
1.3 Installation of light fitting shall include making of connections and proper suspension, support and mounting.
1.4 For suspended fluorescent light fittings suitable length of conduits, ball and socket on junction box are to be provided.
1.5 The majority of the fittings are to be installed in the false ceiling and electrical Contractor has to co-ordinate with false ceiling work for installation.
1.6 The necessary opening in the false ceiling for fixing of lighting fittings will be provided by false ceiling Contractor. The cut-out details are to be given by electrical Contractor.
1.7 The suspension of light fittings for recess mounting in the false ceiling will be to suite site condition.
1.8 The design, manufacture and performance of Luminaries shall comply to all applicable statutes, regulation and safety codes.
1.9 The Luminaries shall be designed for minimum glare and continuous operation without reduction in lamp life or without deterioration of material and internal wiring.
1.10 The fittings shall be designed for low temperature rise and it should be complete with copper choke, starter, reflector etc.
1.11 The power factor improvement capacitor shall be incorporated.
1.12 Outdoor fixture shall be provided with totally weather proof.
1521.13 Each Luminaries shall have terminal for loop in loopout and tee off connection. All internal wiring shall be flexible copper suitable to withstand high temperatures.
1.14 The Luminaries shall be provided with earthing terminal, conduit knockout etc.
1.15 Aluminum used for mirror optic light fitting shall be of high purity and non edging type.
1.16 The reflectors/louvers/diffusers of fittings should be easily approachable and easy to clean without removal, of light fitting.
1.17 The ballast shall be designed to have low power loss and shall be mounted using anti vibration fixing. The ballast should be totally enclosed. The ballast should be all copper wound.
1.18 The ballast which produce humming noise shall be replaced free of cost by the supplier.
1.19 The starter shall be of safety type and shall be replaceable without disturbing reflector or the lamps and without use of any tool.
1.20 The starter shall have brass contact.
1.21 The Luminaries with diffuser shall be of acrylic, non yellowing, non edging type.
1.22 Fluorescent tubes shall be of day light colour type and shall be suitable for use in any position.
1.24 The light fitting shall be fitted as according to the distance measurements as mentioned in the layout drawing.
1.25 Supply of conduits, junction boxes and other hardware shall form part of Contractors scope of work.
1.26 The Contractor shall test, check each fitting before installation.
2. EXHAUST FANS :
2.1 Exhaust fans of sizes 6” & 12" shall be installed as per the distances mentioned in the layout or specified by the Consultant.
2.2 For fixing of an exhaust fan, a circular hole shall be provided in the wall to suit the size of the frame which shall be fixed by means of rag-bolts embedded in the wall. The hole shall be neatly plastered with cement and brought to the original finish of the wall. The exhaust fan shall be connected to exhaust fan point which shall be wired as near to the hole as possible by means for flexible cord, care being taken that the blades rotate in the proper direction.
1532.3 Digging, replastering of wall for installation of exhaust fan and provision of hardware & other material shall be under Contractor's scope of work.
C COMMUNICATION SYSTEM
1.0 TELEPHONE CABLES Telephone pair cables and switch board cables and wires shall be on annealed tinned electrolytic copper conductors, insulated and sheathed with good quality PVC compound as
per BS:6746, twisted pairs bunched together in connecting layers so as to minimise cross- talk and wrapped with Melinex of PVC tape.
Cables shall be manufactured to standard specifications ITD-S/WS-113B, approved make.
Conductor resistance at 20oC, 0.5mm=Max. 98 ohms/Km; 0.6mm=Max. 64 ohms/Km; and 0.71mm=Max. 46 ohms/Km.
2.0 CONDUITS FOR TELEPHONE NETWORK
The rates for conduit work include: a) All necessary spacers and fittings. b) Inspection, junction and outlet boxes as required. c) 3 mm thick perapex sheet covers for inspection and junction boxes. d) All fixing accessories such as clips, nails, screws etc.
e) 2 mm dia G.I. pull wires in conduit work. f) Providing and fixing approved saddle, hooks and grouting the same as required in the case of all exposed conduit work. g) Embedding conduits and accessories in walls, floors etc., during construction and/or cutting chases and making good as necessary in the case of concealed conduit work.
h) Painting all inspection, junction and outlet boxes. i) Providing and fixing approved fixing devices for support of expo conduits and grouting the same as required. j) Painting of perspox sheet cover from inside to suit the colour of the surrounding wall.
3.0 TELEPHONE WIRING
3.1 SYSTEM OF WIRING :- 154The system of wiring shall consist of PVC insulated copper, conductor wires in metallic or non-metallic conduits as called for. All conduits shall be concealed unless otherwise called for.
3.2 GENERAL :- Prior to laying of conduits, the Contractor shall submit the shop drawings for conduit layout indicating the route of conduit, number and size of conduits, location of junction/inspection/pull boxes, point outlet boxes and other details. The shop drawings shall be got approved by the Consultant and then only conduit laying can be started. Any modifications and suggestions shall be approved by the Consultant before the laying of conduits is commenced.
3.3 MATERIALS :- A) Conduits : Conduits for exposed/ underground/ below floors, R.C.C. slab and concealed in walls shall be HMS conduits.
B) P.V.C. Conduits (ISI only) :
PVC conduits shall be rigid unplasticised, heavy gauge having 1.8 mm wall thickness upto 25 mm diameter and 2.0 mm wall thickness for all sizes above 25 mm diameter only HMS & MMS conduits shall be used .
C) PVC Conduit Connections ( ISI only) :- PVC conduits shall be joined by means of screwed or plain couplers depending on whether the conduits are screwed or plain. Where there are long runs of straight runs of straight conduit inspection boxes shall be provided at intervals as approved by the Consultant. The threads pipes and sockets shall be free from grease and oil and shall be thoroughly cleaned before making the screwed/plain joints. Proper jointing materials as recommended by manufacturer shall be used for jointing PVC pipes. Use PVC couplers and connectors for PVC pipe connections and terminating in boxes. All the joints shall be fully watertight.
Junction boxes and running joints shall be provided at suitable places to allow for subsequent extensions if without undue dismantling of conduit system. As far as possible , diagonal run of conduit and adaptable boxes , back outlet boxes, switch boxes and the like must be
provided with entry spouts and smooth PVC bushes.
1553.4 BENDS IN CONDUIT :- Where necessary, bends or diversions may be achieved by means of bends and/or circular inspection boxes with adequate and suitable inlet and outlet screwed joints. In case of recessed system each junction box shall be provided with a cover properly secured and flush with the finished wall surface, so that the conductors inside the conduits are easily accessible. No bends shall have radius less than 2.5 times the outside diameter of the conduit. Heat may be used to soften the PVC conduit for bending.
1563.5 FIXING CONDUITS :- Conduits and junction boxes shall be kept in position while the walls, slabs and floors are under construction and proper hold-fasts shall be so arranged as to facilitate easy drawing of wires through them. Adequate junction boxes of approved shape and size shall be
provided . Where conduits cross expansion joints in the building, adequate expansion fittings or other approved devices shall be used to take care of any relative movement. All conduits shall be installed so as to avoid water pipes. Conduits shall not come in contact with any wooden members unless otherwise stated. Conduits stubs in floor slabs shall be kept as short as possible above the finished floor level in order to avoid any damage to them. After the conduits, junction boxes and outlet boxes are installed in a position ; their outlets shall be properly plugged or covered so that water, mortar, insects or any other foreign matter does not enter in to the conduit system. Exposed conduits shall be fixed by means of spacer bar saddles at intervals not more than 1000mm in normal run & 500 mm from both sides of fittings or accessories. The saddles shall be of galvanised mild steel, flat, properly treated, and painted. Conduits shall be laid in a neat and organized manner as directed and approved by the Consultant. Conduit run shall be planned so as not to be conflict with any other service pipe lines/ ducts. Where exposed conduits are suspended from the structure they shall be clamped firmly and rigidly to hanger of designed to be approved by the Consultant. Where hangers are to be anchored to reinforced concrete, appropriate inserts and necessary devices for their fixing shall be left in position at the time of concreting. Making holes or openings in the concrete generally be not allowed. In case it is unavoidable prior permission of the Consultant shall be obtained.
D LOCAL AREA NETWORK
SCOPE OF WORK :
1. Supply & installation of PVC conduit with all accessories.
2. Supply & installation of Brass outlets.
3. Supply & installation of heavy gauge M. S . box with open able cover.
4. Cutting of chases/opening in floors walls & recementing the same after conduit laying.
5. Preparation of layouts, Charts, Schematics & "as built" drawings.
SUPPLY
PVC conduit :
Conduits & all accessories are as per ISI specification. inside with min. wall thickness of 2 mm. The conduits shall be delivered to the site of construction in original bundles and each length of the conduit shall be with the label of manufacturer.
FLOOR OUTLETS Floor outlet should be fabricated from 2mm thick M.S.sheet steel with top open able cover, gasketed and painted.
INSTALLATION 157CONDUCTING Conducting will be carried out by chiseling the floor and laying and clamping the conduit in the floor & recementing to original level & finish.
DOCUMENTATION Three sets of "as built" cable layout (one retraceable print), single line diagram wiring charts, cable termination details and telephone faults location charts will be submitted.
Unarmoured co- axial cable:
The cable shall be of plain copper conductor of 0.81 mm dia. over dielectric 2.95 mm, impedance 53.5 ohm, attenuation (db/100 mt. 200 MHz) should be max. 23, capacitance 93.5 pf/mt. and max. R.F operating voltage should be 1.9 RMS KV. The cable shall be polythene dielectric, braided with fine copper wires and overall polythene jacketed confirming to B.S.
2316 (UR series) American Military standard MIL-C- 17 (RG series ) The cable manufacturers approval certificate shall be submitted. The inspection will be carried out at manufacturers place if required. The cable test report shall be submitted along cable delivery.
PVC SCREENED UNARMOURED CABLE :
The cable shall be of annealed copper conductor of 0.5 mm dia. polythene insulated, cores colour coded, twisted into pairs, laid up, pvc taped, screened unarmoured and overall polythene jacked confirming to ITD specs NO. S/WS - 113C.
The offered cable shall be multipair & DOT approved make. The cable manufacturer's DOT approval certificate shall be submitted. The inspection will be carried out at manufacturers place if required. The cable test report shall be submitted along cable delivery.
SAFETY CODE
1. First aid appliances including adequate supply of sterilized dressing and cotton wool shall be kept in a readily accessible place.
2. An injured person shall be taken to a public hospital without loss of time, in cases when the injury necessitates hospitalization.
3. Suitable and strong scaffolds should be provided for workmen for all works that cannot safely be done from the ground.
4. No portable single ladder shall be over 8 meters in length. The width between the side rails shall not be less than 30 cm. (clear) and the distance between two adjacent running shall not be more than 30 cm. When a ladder is used an extra mazdoor shall be engaged for holding ladder.
5. The excavated material shall not be placed within 1.5 meters of the edge of the trench half of the depth of trench whichever is more. All trenches and excavations shall be provided with necessary fencing and lighting.
6. Every opening in the floor of a building or in a working platform be provided with suitable means to prevent the fall of persons or materials by providing suitable fencing or railing whose minimum height shall be one meter.
1587. No floor, roof or other part of the structure shall be so overloaded with debris or material as to render it unsafe.
8. Workers employed on mixing and handling material such as asphalt, cement, mortar, concrete and lime shall be provided with protective footwear and rubber hand gloves.
9 Those engaged in welding works shall be provided with welders’ protective eye shield and gloves.
10. (i) No paint containing lead or lead products shall be used except in the form of paste readymade paint.
(ii) Suitable facemasks should be supplied for use by the workers when the paint applied in the form of spray or surface having lead paint dry rubbed and scrapped.
11. Overalls shall be supplied by the contractor to the painters and adequate facilities shall be
provided to enable the working painters to wash during cessation of work.
12 Hoisting machines and tackle used in the works including their attachments anchor and supports shall be in perfect condition.
13. The ropes used in hoisting or lowering material or as a means of suspension shall be durable quality and adequate strength and free form defects.
Note:
The Brands/ Make mentioned in the following List should be used by the contractor and Rate quoted should be based on the same. In case of the brand / make is not available, material of other make should be used with prior approval of Architect and PFRDA. The rates will be revised, based on the difference in the basic rates of the make brands / name mentioned below:
LIST OF APPROVED MANUFACTURERS FOR LT ELECTRICAL WORKS S.N. MATERIALS APPROVED MANUFACTURERS 1 Moulded Case Circuit Breaker (MCCB) i) Schneider ii) Hager iii) Siemens iv) L & T v) Legrand 2 Switch Fuse Unit (SFU) i) L & T ii) Siemens iii) ABB 1593 Power Contactors i) L & T ii) Siemens iii) Schneider 4 Meters i) HPL ii) IMP iii) L & T iv) Trinity 5 Armoured LT cable i) Polycab ii) Finolex iii) R R Kabel iv) CCI 6 Cable Termination i) Dowells ii) Comet 7 Cable Tray i) Profab ii) Metalemms iii) Asian Ancillary Corporation 8 PVC Conduit & Accessories Precisions make only 9 Wires (FRLS) i) RR Kabels ii) Havells iii) Finolex iii) Polycab 10 Modular Switches & Sockets with PVC Box i) MK - (Wrapround model) ii) North West - (NOWA model) iii) Elleys - (E-square model) iv) Vinay - (Corum model) v) Schneider - (Opale model) 11 Distribution Board, MCB, RCCB & RCBO i) Schneider ii) Hager iii) L & T iv) Siemens v) Legrand 12 Voice Cable & accessories i) RR Kabels 160ii) Finolex 13 Light Fixtures i) Wipro ii) Philips iv) GE v) Bajaj 14 Tubes, PL's & CFL's i) Philips ii) Osram 15 Ceiling Fan i) CG ii) Havells iii) Bajaj iv) Orient 16 Exhaust Fan i) CG ii) Almonard iii) Alstom 17 Speakers i) BOSCH ii) Ahuja 18 Amplifier i) BOSCH ii) Ahuja 19 Electrical LT Panel CPRI Approved Panel Manufacturer Only.
20 Capacitors i) Siemens ii) L& T iii) GE iv) ABB iii) Universal 21 CT'S / PT'S i) AE ii) Kappa iii) Ricco iv) Rishabh 22 APFC Relay. i) HPL ii) Emercon iii) Alstom iv) Beluk 161v) L & T 23 Contactor / Timer i) Schneider ii) Hager iii) L & T iv) Siemens iv) Legrand 24 Energy Meters i) HPL ii) Schneider iii) L & T iv) Tecnic v) AE vi) Trinity 25 Concrete Earthing i) Marconite ii) Equivalent as approved by the Client / Consultant 1 All approved material samples shall be approved from the client / consultant / architect.
Client / consultant / architect reserves final right to select any make for any item from the above 2 mentioned list of make.
Client / consultant / architect reserves final right to reject any material if found out of approved list of 3 make / not upto the acceptable standards.
GUIDELINES TO BIDDERS (HVAC)
1. Client : M/s. Pension Fund Regulatory and Development Authority
2. Location : 16th Floor, F- Wing, Maker Tower, Cuffe Parade , Mumbai
3. Scope of work : : AS PER BOQ
4. Completion period : 2 MONTHS
5. Terms of payment : As per the Payment Policy of the PFRDA
Area to be air conditioned : 16th Floor, PFRDA, Maker Tower, F-Wing.
Lighting : 1.5 w/ sft
Fresh air : 7.5 cfm per person or 1 air change per hour,
Design Outside Conditions : 100 deg F Dry Bulb Temperature, 83 deg F Wet Bulb Temperature.
Design Inside Conditions : 24 DEG C +/ - 1 Deg C Testing & handing over All equipment shall be stage – tested during manufacture at the manufacturer’s works as per latest I.S. Specifications and test certificates / reports submitted to the Architect / Interior Designer if desired by them.
162In addition, all equipment and systems shall be tested at site after installation and prior to commissioning as required by the various sections of the Specifications, and test data as required under these Specifications and under section “TEST READINGS” shall be furnished.
Contractors shall leave necessary provisions required for fixing instruments, gauges, meters etc. for testing the equipments and systems.
Performance Guarantee This contract is intended to be a performance based contract whereby the contractor will be liable to execute the work on the basis of the plans and designs hereby given and accepted by him. The contractor will have to guarantee for due and proper performance of the work agreed to be so erected and executed by him.
The performance guarantee shall be valid for a period of 24 months after one year of defect liability period and should cover comprehensive maintenance of system along with efficiency of system , current drawn by units . The contractor shall replace all defective equipment/parts with new components including components subject to normal wear & tear and supply of consumable like refrigerant, oil etc. during the guarantee period and bear all incidental expenses for such work.
SECTION II- TECHNICAL SPECIFICATIONS SPLIT DUCTABLE AIRCONDITIONERS I: AIR COOLED CONDENSING UNIT:
The condensing unit shall be comprise of the following:
A. Compressor (scroll/reciprocating) B. Condenser coil C. Condenser fan with motor.
D. Sheet steel casing & suitable base frame E. Electrical isolating switch.
A. Compressor:- The outdoor units shall comprise of one compressors with internally built high and low pressure cutouts B. Condenser Coil:- One single/double circuited condenser coil, of 3/8” O.D. copper tubing (22 G) with serrated and extended aluminum fins. Tubes shall be arranged in a staggered design for better efficiency. Condenser coil working pressure to be 300 psi.
C. Condenser Fan With Motor:- Axial flow fan for condenser shall be adequately sized and shall be direct driven. The fans shall be selected for low noise level and speed shall not exceed 920 rpm. Condenser fan motor to be IP55 (suitable for outdoor mounting) and all electrical component shall be housed in a water proof enclosure.
D.
E. Sheet Metal Casing:- All duly enclosed in a G.I. powder coated steel sheet cabinet duly made weather proof. The outdoor units shall be mounted on mild steel stands to be
provided by the contractor, to suit the site conditions.
163II: INDOOR UNITS The indoor units shall comprise of a single/double circuited cooling coil, evaporator fan with fan motor duly enclosed in a G.I. powder coated steel sheet cabinet. Suitable angle iron bracing for unit suspension shall be provided. The drain tray shall be insulated and the cabinet shall be acoustically insulated if so required by he contractor to ensure noise level is within acceptable norms as determined and accepted by the client. Filters shall be easily removable and cleanable.
III: REFRIGERANT PIPING The refrigerant piping shall be out of hard / soft quality 22 gauge, pre-pressure tested, copper seamless pipe, of sizes as calculated to limit the pressure drop to 2 F in the suction line and 1 F in the liquid line and hot gas line. The bidder should ensure that the units are capable of delivering the rated capacity and meet the inside design conditions based on the locations of the indoor and outdoor units as shown on the relevant drawing, and also ensure that the air conditioning units can perform, at the distances and elevation differences between the indoor and outdoor units.
Refrigerant pipes should be supported on grooved wooden stripes suitable to accommodate the insulated refrigerant pipes. The piping should be clamped to these wooden strips using a ‘C’ clamps.
The distance between two supports should not be more than 5 ft. wherever the pipes are running on the floor or exposed to view should be covered with 18 G GI tray plastic tray.
IV: DRAIN PIPING Drain piping out of PVC / G.I. medium class pipe shall have to be provided from the indoor unit to the drain point identified by the client. Interconnection between the drain outlet of the indoor unit and the drain pipe may be carried out using P.V.C. hard non-kinkable pipe with excellent water-proof clamping arrangement at the both ends to thoroughly ensure that no water droplets trickle down. A ‘U’ trap of minimum 2 depth, constructed out of hard P.V.C. elbows shall be installed just at the drain outlet of the indoor unit.
IV: TESTING & BALANCING After completion all duct systems shall be tested for air leakage. The entire air distribution system shall be balanced to supply return or exhaust the air quantities as required in the various regions to maintain the specified room conditions.
TECHNICAL SPECIFICATION FOR THE AIR CONDITIONING CONTRACT WORK SR.
Description of work NO 01 Supply of split A/C 1.0 tr. (3/5 star) :- Wall mounted air conditioner shall have 1.0 Tr i.e nominal 12.000 BTU/capacity per hour at the ambient of 40 degree centigrade capacity. Unit shall have maximum 90/46 dB noise level at the distance of 1 MT for outdoor/indoor units. The unit shall be suitable for 230 volts power supply. With temperature indicator and remote for operation. (5- Start AC high wall type split A/C).
The air filter shall be easy to maintain and preferable showing the status of choking. Every unit shall be supported by warrantee of one year however sealed unit war- rantee must be given for 5 years from the manufacturer. CONDESOR MUST BE OF COPPER METAL.
16402 SUPPLY OF SPLIT a/c 1.5 Tr. (3/5 star):- Wall mounted air conditioner shall have 1.5 Tr i.e. Nominal 18,000 BTU/capacity per hour at the ambient of 40 degree centigrade capacity. Unit shall have maximum 90/46 dB noise level at the distant of 1 MT for indoor/outdoor units. The units shall be suitable for 230 volts of power supply. With temperature indicator and remote for the operations. (5- star A/C high wall type split A/C) The air filter shall be easy to maintain and preferably showing the status of choking. Every unit shall be supported by warrantee of one year however sealed unit warrantee must be given for 5 years from the manufacturer. CONDESOR MUST BE OF COPPER METAL.
03 Installation of split 1& 1.5 Tr :- Total work comprising of unpacking till commissioning of each units indoor as well as outdoor.
Connecting the pipes & electrical cables/wires. With necessary support & fabricating for hanging the unit from ceiling. Installation shall be done with the control panel.
The installation of A/C. charging towards installation testing and commissioning of split and cassette A/C. this includes nitrogen flushing, pressure testing, attending leakages, loading, unloading, gas charging and panel fittings.
04 Cassette type indoor units.
These units shall be installed between the bottom of finished slab & top of false ceiling. The maximum allowable height for the cassette type units shall not exceed 350 mm. The unit shall be pre charged with first charge of R 32 / R 134A / R 407 / R 410 refrigerant. Additional charge shall be added as per refrigerant piping at site. The unit must have in built drain pump, suitable for vertical lift of 750 mm.
The unit casing shall be Galvanized Steel Plate / or as per manufacturer’s specifications. Unit must be insulated with sound absorbing thermal insulation material, Polyurethane foam. The noise level of unit at the highest operating level shall not exceed 42 dB(A), at a vertical distance of 1.5 m from the grille of the unit. Unit shall have provision of connecting fresh air without any special chamber & without increasing the total height of the unit (288 mm maximum). The unit shall be supplied with suitable decorative panel.
The unit shall be supplied with Resin Net filter with Mild Resistance. The filter shall be easy to remove, clean & re install. The unit will be connected in series to a suitable outdoor unit & it must be possible to operate the unit independently, through corded/ cordless remote specified in the “Bill of quantities”. The unit will be further connected to Intelligent Building Management System (To be supplied by other vendors) & it shall be possible to operate the unit through this IBMS system. The unit shall be supplied
with following from the factory with following:
Operation Manual Installation Manual Paper pattern for installation Drain hose/ Clamp metal/ Washer fixing plate/ Sealing pads/ Clamps/ Screws/ Washer for hanging bracket/ Insulation for fitting 16505 Extra copper pipe :
a) The contractor shall have to provide extra length of copper pipe with proper lag- ging to make the perfect job of insulation. All the copper pipe shall be without joints and proper flare-up shall be done with tools and tackles for excellent workmanship. No dent shall be allowed while bending the pipe of laying it on connecting it to machine/evaporate/condenser. High grade of foam insulation shall be provided. Entire piping shall be done over the false ceiling and do not compromise any aesthetic look.
b) Then contractor shall have to provide copper pipe with proper lagging to make the perfect job of insulation. All the copper pipe shall be without joints and proper flare- up shall be done with tools and tackles for excellent workmanship. No dent shall be allowed while bending the pipe of laying it or connecting it to machine/evaporator /condense.
High grade of foam insulation shall be provid- ed. Entire piping shall be done over the false ceiling and do not Compromise any aesthetic look. Size of copper shall sleeve insulated with sad- dling and clamping.
06 Wiring :- SPLIT UNIT TO OUTDOOR UNIT The A/C contractor has to get the wiring from the MCB/MCCB unit provided by the electrical contractor in house. All the wiring shall be of approved make only.
The wiring shall pass through ISI approved conduits as mentioned in approved list of materials. Any drilling of the wall for getting copper pipe or wiring shall be sealed and finished by the A.C contractor.
Size of the wires shall be suitable. for each & every A.C unit.
07 Drain water piping :- Condensed water in the interior of the banking hall shall be drained outside/toilet block through gravity-slop. The entire piping shall be 25/32 M.M. ISI approved pipes to carry condensed water. All the piping shall be maintainable and testing shall be done before connecting.
08 supply and installation of fabricated steel supports for outdoor units for (1T.1.5 Tr) 09 Civil work :
The A/C contractor has to complete the zari work in the wall and coordinate with the civil contractor while doing flooring to run the drainage pipe etc. finishing has to be done by the A/C contractor with required labour &materials.
10 COMMUNICATION CABLE AND CONTROL CABLING:
Communication cable and control cabling: Communication cable and control cabling should be of non- polar shielded 2 core cable shall be laid in 20 mm dia PVC conduits of required size. PVC conduit should be clamped neatly maintaining a distance from power cables, Cable terminations and dressing shall be done properly and neatly.
E.01 Unless otherwise mentioned in the Technical specifications, the equipment and materials shall
conform to the following standards:
E.01.01 IS 3615 – Glossary of terms used in refrigeration and air conditioning E.01.02 IS 325 – Three phase induction motors E.01.03 IS 1822 – Motor starters of voltages not exceeding 1000 V E.01.04 IS 996 – Single phase small AC and universal motors E.01.05 IS 1239 – Mild steel tubes, tubulars and other wrought steel fittings E.01.06 IS 3589 – Electrically welded steel pipes for water, gas and sewage E.01.07 IS 6392 – Steel pipe flanges E.01.08 IS 778 – Gun metal gate, globe and check valves for general purposes E.01.09 IS 277 – Galvanised steel sheets E.01.10 IS 737 – Wrought aluminium and aluminium alloy sheet and strip for general engineering purposes 166E.01.11 IS 655 – Metal air ducts E.01.12 IS 732 – Code of practice for electrical wiring and fittings for buildings E.01.13 IS 2516 – AC circuit breakers for voltages not exceeding 1000 V E.01.14 IS 900 – Code of practice for installation and maintenance of induction motors E.01.15 IS 1248 – Direct acting electrical indicating instruments E.01.16 IS 4047 – Heavy duty air break switches and composite units of air break switches and fuses for voltages not exceeding 1000 V E.01.17 IS 8183 – Specification for bonded glass/ mineral wool E.01.18 IS 660 – Safety code for mechanical engineering E.01.19 IS 659 – Safety code for air conditioning E.01.20 IS 5216 – Code for safety procedures and practices in electrical works E.01.21 IS 3016 – Code of practice for fire precautions in welding and cutting operations 11 DAMPERS- All dampers shall be of 18 S.W.G. G.I sheets louver dampers of robust construction and tight fitting.
The design, method of handling and control, shall be suitable for the location and service required.
Dampers shall be provided with suitable links, levers and quadrants as required for their proper operation, control or setting in any desired position. Dampers and their operating devices shall be made robust, easily operable and accessible through suitable access door. Every damper shall have indication device clearly showing the damper position at all times. All the bushing will be of brass only 12 GRILLES AND DIFFUSERS- All grilles (SA & RA), diffusers (SA & RA) will be made from heavy gauge extruded Aluminum sections / M.S. (As specified in the BOQ) duly powder coated to match the interior requirements of Architect / Client. All the supply air grilles/diffusers will be provided with opposed blade dampers fabricated from Al. The damper should be suitable for operation from front face of grille/diffuser.
13. THERMAL INSULATION- The supply air duct shall be insulated with 50/40/25 mm thick, factory backed Aluminum foil fiber-glass of density 24 Kg. / Cu. M.
Method of applying insulation- a. Clean the duct surface to be insulated. b) Apply a thin layer of tar paints. c) Apply a thin coat of hot bitumen or coat of bituminous paint to stick the insulation. d) Fix the insulation of specified thickness over the surface of the duct tightly and seal all the joints using BOPP tape. Secure the insulation with 16 Gauge G. I. wire or 10 mm wire PVC box strapping at a distance of 300 mm.
THERMAL INSUALTION-WITH CLOSED CELL EPE The supply air duct shall be insulated with 25/19/13 mm thick, Closed Cell Expanded Polyethylene.
Method of applying insulation- b. Clean the duct surface to be insulated. c. Apply a thin layer of tar paints. d. Apply a thin coat of rubber solution to stick the insulation. e. Fix the insulation of specified thickness over the surface of the duct tightly and seal all the joints using BOPP tape. Secure the insulation with 16 Gauge G. I. wire or 10 mm wire PVC box strapping at a distance of 300 mm.
ACOUSTIC INSULATION- 167First 3 meter length of supply air duct shall be acoustically insulated with 12.5 mm thick fiberglass of density 48 Kg./Cu.M. and covered with 28 G perforated Aluminum sheets from the inside of the duct.
a) Apply a thin layer of tar paints. b) Fix-up fiberglass slabs c) Cover-up with perforated Aluminum sheets with the help of G. I. Screw Was 14 VARIABLE REFRIGERANT FLOW SYSTEM 1 Scope:
The scope of this section comprises the supply, erection, testing and commissioning of Variable Refrigerant Volume System conforming to these specifications and in accordance with the requirements of Drawings and Bill of Quantities.
2 Type:
Unit shall be air cooled, variable refrigerant volume air conditioner consisting of one out- door unit and multiple indoor units. Each indoor unit having capability to cool independently for the requirement of the rooms. All indoor units shall be provided with isolation valves so that a particular unit can be isolated and removed for servicing, while system keeps functioning in normal way.
It shall be possible to connect multiple indoor units on one refrigerant circuit as shown in the drawings or as indicated in Bill of Quantities. The indoor units on any circuit can be of different type and also controlled individually. Following type of indoor units shall be connected to the system:
- Ceiling mounted cassette type. - Wall Mounted Split type - Compressor installed in outdoor unit shall be equipped with capacity control mechanism and capable of changing the rotating speed / mass flow rate of refrigerant by scroll engaging / disengaging mechanism to follow variations in cooling. Outdoor unit shall be suitable for mix-match connection of all type of indoor units.
The refrigerant piping between indoor units and outdoor units shall be extended up to 100m with maximum 50 m level difference without any oil traps. Oil recovery system shall be managed without disturbance to normal operation cycle of the system / compressor.
Both indoor unit and outdoor unit shall be factory assembled, tested and filled with first charge of refrigerant before delivery at site 15 PROCEDURE FOR CARRYING OUT PRESSURE TEST
1) Ensure that the tubing to be tested is properly secured/supported and the openings have been sealed off as per manufacturer's recommendation.
2) Install pressure gauge/s at strategic location/s where it shall not be tampered with, at the same time, should be easily visible.
3) Install a valve and connecting tubing so that the open end of the tube reaches the cylinder outlet without moving the cylinder.
4) Connect the tube to the cylinder and after ensuring proper connection, crack open the cylinder valve, keeping an eye on the pressure gauge. Let the pressure rise to around10 psig.
5) Check for proper sealing of all flanged / flare nut joints or valves/ valve glands looking for noise of escaping Nitrogen and seal same.
6) Open the cylinder valve again and raise the pressure to 200 psig.
7) Check the tube line for major leakages at brazed joints, elbows, valve glands, equipment end connections and tube seams with the help of soap water. Make up the leaks by tightening nuts. If the leaks are in brazed joints, flush out Nitrogen and carry out necessary re-brazing.
8) Open the cylinder valve again and increase the pressure to 150 psig less than the final test pressure.
Repeat leak check as above.
1689) Open the cylinder valve again and slowly raise the pressure to the manufacturer recommended pressure. Carry out a thorough leak check.
10) Record the pressure and time. Let the pressure stand for 24 hours without tampering. Check the pressure again after 24 hours. If pressure has dropped, the tubing should be checked very thoroughly for minor leakages. It is important to follow this 24 hours period as it gives enough time to detect minute leakages, and it removes the doubt created by thermal expansion of Nitrogen ( as after exact 24 hours, ambient conditions are generally same) List of Approved Makes Sr. No. DESCRIPTION MAKE LOW SIDE HVAC ITEMS 1 Ducting Sheet Tata / Jindal / SAIL / Uttam / Eq.
2 Ducting Factory Fabricated Rolastar / Ductofab / windcatcher Alp Aeroflex/Alp 3 Duct Insulation Accosound/Vedoflex/Aerobatic / Eq.
Diffuser / Grilles / Volume control Cosmos / Airproduct / Airmaster / 4 dampers (VCD) / Fire Damper / Ruskin Louvers / VAV / Jet Nozzle 5 Cables Polycab/KEI/Eq.
SAFETY CODE
1. The first aid appliance adequate supply of sterilized dressings and cotton wood shall be maintained in a readily accessible place
2. An injured person shall be taken to public hospital without loss of time, in case where the injury necessitates hospitalization.
3. Suitable and strong scaffolds should be provided for workmen for all works that cannot safely be done from ground.
4. No portable single ladder shall be over 8 meter in length. The width between the side rails shall not be less than 30 cm. (clear) and distance between two adjacent ranges shall not be more than 30 cm. When the ladder is used on an extremes door shall be engaged for holding the ladder.
5. Every opening in the floor of the building as in a working platform be provided with suitable means to prevent fall of persons or materials be providing suitable fencing or railing where minimum height shall be one meter.
1696. No floor, roof or other part of structure shall be overloaded with debris or materials as to render it unsafe.
170VI. Declaration-Cum- Certificate on the Letter Head of Bidder Regarding Restrictions on Procurement From Bidders From A Country Or Countries, On Grounds Of Defence In India, Or Matters Directly Related Thereto, Including National Security.
Restrictions under Rule 144 (XI) of General Financial Rules 2017 of Ministry of Finance, India order no. F. No 6/18/2019/PPD dated 23rd July 2020 I/We have read the clause regarding restrictions on procurement from a bidder of a country which shares a land border with India;
I/We, the bidder (Specify full name ------------------------------------------ -------------------------------) certify that we are NOT from such a country OR, if from such a country, has been registered with Competent Authority.
I/We hereby certify that we fulfil all requirements in this regard and is eligible to be considered. (Signature of Authorised Signatory along with Seal)
Name of authorised signatory:
Designation of Authorised signatory:
List of Evidences enclosed:
1. Copy of certificate of valid registration with the Competent Authority (Score out if not applicable)
2. ……….
3. ………..
4. ………..
Date:
Place:
171GE1N2 'M-7G" Rx' s1 C1'A-9B"IN CHIEF1 2G'E-7N" Mx G1R3''-s0 "CABIN WAE SX HE C RM LIFT LIFT UTILITY AREA EXEC.
WASH ROOM LIFT LIFT UTILITY AREA LIFT LIFT SR. EX1E6C'-.0 D" IxN 2N1IN'-6G" AREA KIT1C0H'-E2N" x/ P2A1'N-6T"RY PROPOSED INTERIOR PLAN OF MUMBAI REGIONAL OFFICE OF R RE -1V D 13A -T 0E 1-2026 R DE UD V R E A INS S G C P PER PRI T P D (T I 9SI -O C 01N -26) (R 9D -- 10A - T ( 2PE 0P: 2T 6) ) AC MH OEC L.K PE .D S: SHETGIRI & ASSOCIATES PFRDA AT 16TH FLOOR, F-WING, MAKER TOWERS, CUFFE R-2 14-01-2026 REV AS DISC AT C.O SCALE: DRAWN:
PARADE, MUMBAI - 400 005. NTS S & A
FILE NO: DRAWING NO.:
PFRDA/MUM/ PFRDA/MUM/ E.mail : shetgiri@shetgiriassociates.in RO/CUFP/01 RO/CUFP/7375/1 e g a s s a P e d i W "6-'5 Hand Wash Area KITC1H0'E-9N" /x P 9A'-N0T"RY 3E2X'E-0C"U xT I1V3E'- D3"IN (AINvGg) SR. EX NEC PE. SN O T SFR &EFY CI C TTE IO O S NECTION BInreAfoarrkem a-oault PH5O'-0NE" xB 3O'-O2"TH OFFICE 4W0O'-4R"K xS T2A2T'-I6O"N AREA EXEC. EONFFTRICYE TSOECTION H SO RN . E'B XL EE CE C N OHT FAR &FPY ICI RT EOP SE ER CS TO ION N's RECEPTIO1N1 '&-2 "W xA 2IT1I'N-0G" LOUNGE OFFICER's WORKSTATIONS SJtaonraitgoer FRS OR M. MEX AE NKC PE E. SN RO T STFR &EOFY CI W C TTE IEO O RS NSE C 'ET I WON ING' GENERAL GENERAL WASH ROOM WASH ROOM ReDceepsktion NPS TR3U2S'-T0 O" FxF 2IC7'E-0 S"ECTION NPS OFFICER'(s1 W8)ORKSTATIONS SR. FUN12C'T-7IO" NxA 1R6Y'- 1C0H"AMBER GENERAL WASH ROOM EXEC. WG AE SN HE RR OA OL M MA LK I' FFE T R W LT OIO N BW G B'E YRS RW OA OS MH (A t Et ot S Xa Rtc Ehh . Ceed WAITING) GENERAL ReDceepsktion WASH ROOM GENERAL WASH ROOM yalpsiD llaW oediV SLDROIS.U CEN 1UXG 9E SE 'C S- 0U&IO"T DNXIVI GE C2 NH7W '-IAT 6A MA "I BRTI EINERGS HON' 1B 8LC'E -H6 CA"H MXA BI 2ER 7RP '-E 6"RSON 12A'-N6T"E X R 6M'-0" SR. EXEC. CONFE4R3E'-N0C" EX R 1O5O'-6M" / BOARD ROOM yalpsiD llaW oediV L.H.STORAGE UNIT L.H.STORAGE UNIT L.H.STORAGE UNIT NPS1. 2S'-R0." ExX 1EC2' -C9"ABIN NPS9 E'-X9E"C x C 1A2B'-I9N" # 1 NPS 9E'-X9E"C x C 1A2B'-I9N" # 2 DY. GE1N2 'M-7G" Rx C8'A-4B"IN # 1 L.H.STORAGE UNIT L.H.STORAGE UNIT L.H.STORAGE UNIT L.H.STORAGE UNIT CHIEF1 3G'E-0N" Mx G1R2''-s7 "CABIN GE1N1 'M-9G" Rx' s1 C2'A-7B"IN DY. GE8N'- 4M" GxR 1 2C'-A7B"IN # 1DY. GE8N'- 4M" GxR 1 C2'A-7B"IN # 2 BIrneAfoarrkem a-oault L.H.STORAGE UNIT WITH PLANTERS Security Desk 5'-0" (Avg) W i d e P a s s a g e L.H.STORAGE UNIT WITH PLANTERS L.H.STORAGE UNIT WITH PLANTERS OFFICER's W(4O)RKSTATIONS OFFICER's W(3O)RKSTATIONS OFFICER's W(4O)RKSTATIONS LED WALL DISPLAY COLL1A0B'- 9S"I Tx- O2U1'T-0 "AREA 1S1E'C-0R"E XTA 1R5I'A-6T" OFFICER's W(4O)RKSTATIONS (4) OFFICER's W(4O)RKSTATIONS TINU EGAROTS.H.L TINU EGAROTS.H.L TINU EGAROTS.H.L TINU EGAROTS.H.L DY. GE1N2 'M-7G" Rx C8'A-4B"IN # 2 TINU EGAROTS.H.L L.H.STORAGE S(SITP-OACU 1ET 2 /FB '-OR 7RE " A xSK U7- 'BO -6-U "STT AAFRFE)A STAFF WO(R6K)STATIONS S1E0C'-R3E" TxA 8R'-I6A"T EX(ENC 2P. 1 SM ' -&4E "EG T xEI NN1G 1E' R-R 9A"OLO)M EN(CO1Lu2Ot's-S 7idU "e R x ET 8o L '-ilO 0e"Bt)BY (PRSEPSAENCET FOOP2RT1I 'FO-4UN"T -xU WR 10EA' -IE 0TX "INPGAN LSOIOUNNGE) EN(CO6LuO '-ts6Si"Ud exR E 4T 'o-L 6iOl"eBt)BY 5'-6" (A v g) W i d e P a s s a g e R-3 20-01-2026 REV AS DISC R-4 24-01-2026 REV AS DISC 172PROPOSED INTERIOR RENOVATION & FURNISHING WORKS FOR OFFICE OF PFRDA, 16TH FLOOR, MAKER TOWERS - F, CUFFE PARADE, MUMBAI SUMMARY STATEMENT OF COST OF THE PROJECT WORKS S.NO DESCRIPTION OF WORKS AMOUNT IN INR GRAND TOTAL COST OF THE CIVIL & INTERIOR RENOVATION & 1 Rs. 4 ,78,85,478.02 FURNITURE WORKS GRANDTOTALCOSTOFELECTRICALINSTALLATION,LV,UPS&HVAC 2 Rs. 2 ,32,79,668.82 WORKS (Rs.) 3 GRAND TOTAL COST OF AV WORKS (Rs.) Rs. 8 3,52,240.00 GRAND TOTAL COST OF THE PROJECT WORKS Rs. 7 ,95,17,386.84
Note:TheRatesandAmountquotedhereinaboveshallbeExclusive of GST. GST as applicable based on the prevailing rate, rules, regulations & guidelines shall be additional at actuals.
For SHETGIRI AND ASSOCIATES 173PROPOSED INTERIOR RENOVATION & FURNISHING WORKS FOR OFFICE OF PFRDA, 16TH FLOOR, MAKER TOWERS - F, CUFFE PARADE, MUMBAI SUMMARY STATEMENT OF INTERIOR RENOVATION, CIVIL & FURNITURE WORKS S.NO DESCRIPTION OF WORKS AMOUNT IN INR 1 GRAND TOTAL COST OF SCHEDULE I - CIVIL & INTERIOR WORKS Rs. 3,69,21,178.02 2 GRAND TOTAL COST OF SCHEDULE II - LOOSE FURNITURE WORKS Rs. 1,09,64,300.00 GRAND TOTAL COST OF THE CIVIL & INTERIOR RENOVATION & Rs. 4,78,85,478.02 FURNITURE WORKS
Note:TheRatesandAmountquotedhereinaboveshallbeExclusive of GST. GST as applicable based on the prevailing rate, rules, regulations & guidelines shall be additional at actuals.
For SHETGIRI AND ASSOCIATES 174PROPOSED INTERIOR RENOVATION & FURNISHING WORKS FOR OFFICE OF PFRDA, 16TH FLOOR, MAKER TOWERS - F, CUFFE PARADE, MUMBAI CPWD DSR S. NO. DESCRIPTION OF WORKS QTY UNIT RATE AMOUNT IN INR NO / MR SCHEDULE I - CIVIL & INTERIOR WORKS
SECTION A : - CIVIL WORKS
General Notes: Rate should be inclusive of material,labour,tools, machinery, scaffolding, final disposal of debris, cleaning cutting wastage etc, alltaxes, transportation etc complete. (ExcludingGST) GST will be paid as Applicable at the time of payment of Bills.
Contractor shall get all materails approved from Architect/ PFRDA before using it on site from approved make list. Contractor shall not use any material beyond approved make list. Contractor shall read all specifiations carefully and visit site before quoting the rates and understand the scope of work. In case any discrepancy / interpretation.
PFRDA's decision will be final and binding to the contractor.
Dismantling of existing Furniture as per instruction by Architect / Engineer, all temporary provision for successful running of branch during renovation work, alsoall unservicable materials/ debris etc shall be disposed off to commondumping ground as permitted by Corporationisinthescopeofcontractoratnoextracostandcontracor shouldmofapprovedmake,shade&texture. class3.0mmthkveneer withmelaminepolishetccomplete.ermsoftheSq.Ftsareacalculated in and over the Plan view i.e. overall footprint area 1 MR Demolition / dismantaling Demolishing / Dismantaling of the existing Flooring, dado, tiling, partitions, false ceiling, Platforms, counters, stone or brick work, plaster, bunds, walls, doors, windows, Glass Facade, Glazing of any type, ACPCladding,Louversetc,fans,lightingfixtures,cables&wires,AC ducts & grills, AC assessories, Fire pipes, Sprinklers, Electrical Assessories, fittings, fixtures, table &credenzas, storageunits ofall types,furniture&fixtures,workstations,Interioritems,fixed&loose 1 Lumpsum 1 ,50,000.00 1 ,50,000.00 items etc and any other material required for working on site & complianceofalltheactivitiesonsiteincludingremovalofdebrisfrom site including removing the same with utmost care to ensure no damageincaseoffixtures&fittings&handingoverthesametoPFRDA orshiftingthesametoanewdesiredplaceandre-fixingthesameif desired under the instructions and directions of the Client / Architect
Note:-TheratequotedfortheitemofDemolition&Dismantlingto includeremovalofday-to-daydebrisgeneratedfromsiteduringthe courseofexecutionoftheprojectandtonearestdumpyardwithinthe MCGMdesignatedlocationuptoanyleadandliftincludingcarriageof debris, loading-unloading etc complete at regular intervals.
Housekeeping on day to day basis from the start of project till handover of completed site topfrda Bank shall be included in the quotedratefortheitemofDemolishing/Dismantaling.Thedemolition rate to be inclusive of carting away, all royalties etc complete.
2 Modified DSRAAC Block Partitions
6.38 Providing and laying Autoclaved Aerated concrete(AAC) blocks masonry100mm/125mmthickwithGrade-1AACblocksofdensity 551to650kg/cumconformingtoIS:2185(Part3)insuperstructure aboveplinthleveluptofloorVlevelincementmortar1:4(1cement:4 7 Cu. Mts 1 0,195.45 7 1,368.15 coarsesand).Therateincludesprovidingandplacinginposition2Nos 6 mm dia M.S. bars at every third course of masonry work.
Therateshallalsoincludeclosingthegapbetweenthemasonaryand rccbeam/slabfinishedtorequiredslopeasdirectedbyengineerin charge. The AAC block to withstand the standard fire for240mins underuniformcompressiveloadof15kg/m2asperIS:3809,BS:476 part 20 and ISO 834 with certification.
3 Brick Wall Partitions
6.13 Half brick masonry with common burnt clay F.P.S. (non modular) bricks of class designation 7.5 in superstructure above plinth level up to floor 200 Sq. Mtr. 1 ,123.80 2 ,24,760.00 V level. Cement mortar 1:4 (1 cement :4 coarse sand)
6.14 Extra for half brick masonry in superstructure, above floor V level for 200 Sq. Mtr. 4 5.00 9 ,000.00 every four floors or part thereof by mechanical means.
6.15 Extra for providing and placing in position 2 Nos 6 mm dia. M.S. bars at 200 Sq. Mtr. 1 04.80 2 0,960.00 every third course of half brick masonry.
Note:-Theaboverateshallbeincludingnecessaryscaffoldinguptoany height,strikingjoints,curingetccompleteasdirected.Thebricksshall conform to the relevant IS codes etc complete.
1754 Cement plaster 475 Sq. Mtr. 4 77.90 2 ,27,002.50
13.8 15mmcementplasteronroughsideofsingleorhalfbrickwallfinished
with a floating coat of neat cement of mix :
13.8.2 1:4 (1 cement: 4 fine sand) 5 POLYMER MODIFIED MORTAR/CONCRETE
26.34 Carefullybreaking&removingtheexistingdamaged/corrodedR.C.C.
Columns, beam, slabs, chajjas, paradis, fins etcincluding disposal& catingawayofthedebris,cleaningetcinthepatchesorlongstretches by means of light chisel upto 50mm depth, upto the level of reinforcement without damaging brickwork, plaster in the vicinity, including Providing and laying SBR Polymer modified (of approved make @ minimum 2% by wt. of cement used) plain/reinforced concrete jacketforthestructuralmemberse.g.columns,pillars,piers,beamsetc with concrete having the specified minimum characteristic compressivestrength[withordinaryportlandcement,coarsesandand gradedstoneaggregateof10mmmaximumsizeinproportionasper designcriteria]withspecifiedaveragethicknessall-roundexistingcore of RCC member.
Note: Rates shall be forfinished surfacearea ofconcrete andshall includethecostofmakingholesinexistingRCCslab,ifrequired,for pouring concrete in shuttering mould of jacket and appropriate approved Super-Plasticiser for rendering concrete as flowable self compactingandSBRpolymerbutshallexcludecostofreinforcement, bondcoat,ShearKeys,centeringandshuttering,strutting,proppingetc (Paymentunderthisitemshallbemadeonlyafterproperwetcuring has been done and surface has been satisfactorily evaluated by sounding/tapping with a blunt metal instrument)
26.34.1 50mmthickinGradeM25withcementcontentnotlessthan330kg 300 Sq. Mtr. 5 69.15 1 ,70,745.00 per cum RateshallincludeProviding&applyingRusticideRustprime/RuskillA or approved equivalent in one or more coats as directed as per manufacturersspecification,washingwithwaterincludingBondCoat as permanufacturers specifications and standards includingcuring, scaffolding, cleaning, necessary compaction with mechanical plate vibratoretc.completetothesatisfactionoftheEIC,etc.complete.Mode of measurement- per sqmt of breaking area of concrete.
6 MR MICRO-CONCRETE TREATMENT 1500 Kgs 2 00.00 3 ,00,000.00 Replacingthecarbonatedpartofconcreteandrepairingthedamaged surfaceofconcrete,fixtheformworkacrosstheprofileofdamaged structural element. Providing superfluid microconcrete including mixing, transporting, placing compacting, curing etc. complete but excluding reinforcement and formwork. (Payment on the basis of actualconsumptionofMicro-concrete)bypouringthefreeflowmicro- concretemixintheformwork.Makeupconcreteisbasedontypeof structuralelementanditslocationincludingCenteringandshuttering, struttings, propping etc. and removal of formwork in 12 mmthick plywood, including application of shuttering oil, etc complete with steelpropstosupportthestructureprovisionallyduringrepairand jacketingetc.andmaintainingtheminpositiontillrequiredasdirected by the consultant.
1767 MR CRACK FILLING WITH PMCM 750 R.Mtrs 4 50.00 3 ,37,500.00 Carefully removing the existing plaster / mortar / loose concrete, chasing the cracks, including supplying, providing & errecting in positionthenecessaryscaffolding,disposal&catingawayofthedebris, cleaning etc & sealing the separation cracks between R.C.C. and brickworkbyraking,openthecrackbyelectricallyoperatinggroove cutter as directed, insertion of 20 mm downgraded aggregates by hammering as per the instructions of the consultant, sealing with polymermodifiedcementatiousmortar(25mmwidthx25mmdepth) usingPolyalkEPorequivalentasperthespecificationofitempolymer modifiedcementatiousmortar/concrete,applicationofchickenmesh( 200mmwide,200mmoverlappinglength)alongthecrackby'U'nails spacedat300mmc/c,includingnecessarybreakingplaster,concrete, brickwork, washing with water, curing, cleaning etc. complete with steelpropstosupportthestructureprovisionallyduringrepairand jacketingetc.andmaintainingtheminpositiontillrequiredasdirected by the consultant.
8 MR Civil works for Air Conditioning 25 No. 1 ,200.00 3 0,000.00 Carrying out required civilworks like chiseling work, concealing of drainpipesinnecessaryslopes,plasteringandmakinggoodthewalls/ surfaces, etc for implementation of the necessary Air Conditioning works etc complete 9 Waterproofing for Toilet Blocks and Pantry Area 175 Sq. Mtr. 6 17.05 1 ,07,983.75 A 22.5 Providingandlayingwaterproofingtreatmentinsunkenportionof WCs, bathroom etc., by applying cement slurry mixed with water
proofing cement compound consisting of applying :
(a)Firstlayerofslurryofcement@0.488kg/sqmmixedwithwater proofing cement compound @ 0.253 kg/ sqm. This layer will be allowed to air cure for 4 hours.
(b)Secondlayerofslurryofcement@0.242kg/sqmmixedwithwater proofingcementcompound@0.126kg/sqm.Thislayerwillbeallowed to air cure for 4 hours followed with water curing for 48 hours.
Therateincludespreparationofsurface,treatmentandsealingofall joints,corners,junctionsofpipesand masonrywith polymermixed slurry.
B 22.3 Providing and laying water proofing treatment to vertical and horizontalsurfacesofdepressedportionsofW.C.,kitchenandthelike 175 Sq. Mtr. 7 69.60 1 ,34,680.00
consisting of:
(i) Ist course of applying cement slurry @ 4.4 kg/sqm mixed with
waterproofing compound conforming to IS : 2645 in recommended proportionsincludingroundingoffjunctionofverticalandhorizontal surface.
(ii)IIndcourseof20mmcementplaster1:3(1cement:3coarsesand) mixed with water proofing compound in recommended proportion including rounding off junction of vertical and horizontal surface.
(iii)IIIrdcourseofapplyingblownorresidualbitumenappliedhotat
1.7 kg. per sqm of area.
(iv)IVthcourseof400micronthickPVCsheet.(Overlapsatjointsof PVCsheet should be 100 mmwide and pasted toeach other with bitumen @ 1.7 kg/sqm).
10 PCC / I.P.S. up to 4" ht. 30 cum. 9 ,895.20 2 ,96,856.00
4.2 Providingandlayingcementconcreteinretainingwalls,returnwalls, walls (any thickness), FLOORING / BENEATH FLOOR FINISHES includingattachedpilasters,columns,piers,abutments,pillars,posts, struts, buttresses, string or lacing courses, parapets, coping, bed blocks,anchorblocks,plainwindowsills,fillets,sunkenflooretc.,upto floor five level, excluding the cost of centering, shuttering and finishing
4.2.3 1:2:4(1Cement:2coarsesand(zone-III)derivedfromnaturalsources :4gradedstoneaggregate20mmnominalsizederivedfromnatural sources) 11 Granite Door & Window framing Modified 8.2 Providing and fixing 18 mm thick gang saw cut, mirror polished, premouldedandprepolished,machinecutforkitchenplatforms,vanity counters, windowsills,facias andsimilar locationsofrequiredsize, approvedshade,colourandtexturelaidover20mmthickbasecement mortar 1:4 (1 cement : 4 coarse sand), joints treated with white cement, mixed with matching pigment, epoxy touch ups, including rubbing, curing, moulding and polishing ofedges togive highgloss finish etc. complete at all levels.
8.2.2 Granite stone slab of colour black, Cherry/Ruby red
8.2.2.1 Area of slab upto 0.50 sqm 97 Sq. Mtr. 5 ,413.50 5 ,25,109.50
8.2.2.2 Area of slab over 0.50 sqm 18 Sq. Mtr. 5 ,136.30 9 2,453.40
Note:-RatewouldincludeProvidingandFixingwindowframingeither insingle/doublepattiwhichshallbequantifiedasasingleentityin termsofSq.MtsoverthePlanareaoftheGranitestone(Doublepatti would be considered and measured as single length X total width irrespectiveofsingleordoublepatti/itsthickness)andincludingedge polishing etc in desired pattern etc complete as per drawings & directions.Rateshallincludecuring,washing,cleaningetccompleteas per drawings & details and as directed.
17712 8.3 Providing edge moulding to 18 mm thick marble stone counters, Vanitiesetc.,includingmachinepolishingtoedgetogivehighgloss finish etc complete as per design approved by Engineer-in-Charge.
8.3.2 Granite work 465 R.Mtrs 5 10.95 2 ,37,591.75 13 Precast Reinforced Cement Concrete Lintels A 5.13 Providing,hoistingandfixinguptofloorfivelevelprecastreinforced cementconcreteinsmalllintelsnotexceeding1.5mclearspanupto floorfivelevel,includingthecostofrequiredcentering,shutteringbut, includingthecostofreinforcementwith1:1.5:3(1cement:1.5coarse 3 C.Mts 1 4,325.95 4 2,977.85 sand (zone-III) derived from natural sources : 3 graded stone aggregate 20 mm nominal size derived from natural sources).
B 5.22A Steel reinforcement for R.C.C. work including straightening, cutting, bending, placing in position and binding all complete above plinth level.
5.22A.6 Thermo-Mechanically Treated bars of grade Fe-500D or 450 Kgs 1 07.85 4 8,532.50 more.
14 FLOORING : a Vitrified Tiles
11.41A ProvidingandlayingVitrifiedtilesinfloorindifferentsizes(thickness tobespecifiedbythemanufacturer)withwaterabsorptionlessthan
0.08%andconformingtoIS:15622,ofapprovedbrand&manufacturer, inallcoloursandshade,laidon20mmthickcementmortar1:4(1
cement:4coarsesand)jointingwithgreycementslurry@3.3kg/sqm includinggroutingthejointswithwhitecementandmatchingpigments etc.Thetilesmustbecutwiththezerochippingdiamondcutteronly.
Layingoftileswillbedonewiththenotchtrowel,plier,wedge,clipsof requiredthickness,levelingsystemandrubbermalletforplacingthe tiles gently and easily.
Modified Doublechargevitrifiedtilepolishedfinish/Glazedvitrifiedfloortiles
11.41A.1 polished finish / Full Body Vitrified Tiles of requisite size as below:
Modified Size of Tile 1000 x 1000 mm 100 Sq. Mtr. 2 ,500.00 2 ,50,000.00
11.41A.1.5
Note:-Tilesshallbefreeofanyvariationincolourortexture.Rateshall alsoincludelayingplasticprotectivecoversheetforflooringworks& removing when directed. Makes shall be Johnson, Kajaria, Ntico, Simpolo or equivalant approved by the Organisation.
The rate shall also include sealer treatment ofapproved makes & application chemicals and Roffe including providing and laying in positionPCCuptoanythicknessbeneaththefloorfinisheswherever leveldifferenceisobservedtoattainauniformlevelallthroughoutthe premisesasperdirections&instructionsoftheArchitectetccomplete.
(Basic rate of tiles shall be Rs. 125 / Sq Fts.) b MR Anti-Skid/CeramicTileFlooringforpantry/toilet:(600mmx600 175 Sq. Mtr. 1 ,510.00 2 ,64,250.00 mm) Providing and laying 1st quality Ceramic tiles/Anti-Skid tiles of approvedmakeandshadeofsize600mmx600mmandthicknessas permanufacturer'sstandardsandasapprovedbyArchitect/Engineer in charge in flooring in a required pattern and design over and including25to30mmthk.bedofCementMortar1:4(1Cement:4 Coarse sand ) in proper line and level including neat white cement float, fillingjointswithneatcementslurry,ofappropriatecolour,curingand cleaning complete.Tiles shall be free of any variation in colour or texture,andlayingplasticsheet&18mmthk.POPprotectivecoveron flooring and removing when directed. The cost to include sealer treatmentofAquamixbrand.(Make:Johnson,Kajaria,Nitco,Somany, Orient, Euro or equivalant approved by the Organisation).
c MR Vitrified Tile for Dado - Toilet area & Pantry (450 mm x 600 mm) 300 Sq. Mtr. 1 ,460.00 4 ,38,000.00 Providingandlaying1stqualityVitrified tilesofapprovedmakeand shadeincludingDigitalPrintandbevellededgeTilesofsize450x600 for toilet dado including backing plaster in CM 1:4 as per manufacturersdesignbrochureandincombinationoftwodesigntiles includingfillingthejointswithepoxybasedjointfillingcompound,base coatetccompleteanduptoaheightof7'-0"aspertheinstructionsof the consultant. (Make: Johnson, Kajaria, Nitco, Somany, Orient or equivalant approved by the Organisation).
d MR ProvidingandlayingLaminatedWooden flooringofapprovedmake such as (Armstrong / Krishna Vinyl / Square Foot / Pergo / GreenWood/Pavimento/Xylos/Finsaorequivalentapprovedmake) onfloorasperthedrawing&instructionsonlevelledfloorsurfaceof theapplicationarea,whichshallbedonebyprovidingandlayingin positionPCCofupto4"thkbeneaththefloorfinisheswhereverlevel 310 Sq. Mtr. 2 ,700.00 8 ,37,000.00 difference is observed to attain a uniform level all throughout the premisesasperdirections&instructionsoftheArchitectandwhich shallbeincludedintheitemratequotedherein,insulatingtheareas, surface preparation, bedding, finishing, polishing, cleaning etc complete as per the directions and instructions of the Consultant.
178Therateshallbeinclusiveofedgemoulding&endstripsatthejunction betweenthefloorandtheverticalsurfacesandmouldings,Tgrooves etccompleteasperthedirections/tothesatisfactionoftheArchitect includingbackingetccompleteasdirectedbytheArchitect.(Basicrate of tiles = Rs. 180 / Sq Fts.) e 11.56 ProvidingandlayingPolishedGranitestoneflooringinrequireddesign andpatterns,inlinearaswellascurvilinearportionsofthebuildingall completeasperthearchitecturaldrawingswith18mmthickstone slabover20mm(average)thickbaseofcementmortar1:4(1cement:
4coarsesand)laidandjointedwithcementslurryandpointingwith 80 Sq. Mtr. 4 ,481.30 3 ,58,504.00 white cement slurry admixed with pigment of matching shade includingrubbing,curingandpolishingetc.allcompleteasspecified and as directed by the Engineer-in-Charge.
11.56.1 Polished Granite stone slab of colour Black, Cherry/Ruby Red or equivalent approved f (i) Modified Providingandlayingmachinecut,mirrorpolished,ItalianMarblestone
11.51 forflooringandDadoworkslaidinrequiredpatterninlinearportionof thebuildingallcompleteasperarchitecturaldrawings,with18mm thickstoneslablaidover20mm(average)thickbaseofcementmortar 1:4 (1 cement :4 coarsesand) laidand jointedwith whitecement slurry @ 4.4 kg/sqm including pointing with white cement slurry admixedwithpigmenttomatchthemarbleshadeincludingrubbing, curingandpolishingetc.allcompleteasspecifiedandasdirectedby the Engineer-in-Charge.
Modified 18mmthickItalianMarblestoneslab,Perlato,Rossoverona,FireRed
11.51.1 or Dark Emperadore etc. 250 Sq. Mtr. 6 ,603.35 1 6,50,837.50
(ii) 11.52 Providing and laying machine cut, mirror polished Marble stone flooring,inrequireddesign(Simplegeometrical,abstractetc.)andin patternsincombinationwithItalianmarblestonesofdifferentcolours, shades and finished surface texture etc., in linear portions of the building,allcompleteasperthearchitecturaldrawings,with18mm thickstoneslablaidover20mm(average)thickbaseofcementmortar 1:4 (1 cement :4 coarsesand) laidand jointedwith whitecement slurry @ 4.4 kg/sqm, including pointing with white cement slurry admixedwithpigmenttomatchthemarbleshade,includingrubbing, curingandpolishingetc.allcompleteasspecifiedandasdirectedby the Engineer-in-Charge.
11.52.1 18mmthickItalianMarblestoneslab,Perlato,Rossoverona,FireRed 70 Sq. Mtr. 6 ,927.35 4 ,84,914.50 or Dark Emperadore etc. g MR Providing and Laying Synthetic high grade & high class designer & ImportedCarpetofKRAUS, SHAW,BRINTONS,ECOSOFTINDIAPVT.
LTDorequivalentmake,26Ounces.ThecarpetshallbeinCarpetTile formwithCushionBackingPVCfreetilewithfibre-glassofrequired size.Thenecessaryfoambackingofmaximumupto10mmfoamincase of undulations (If any) shall be provided as per the directions & instructions of the Consultant & shall possess requisite chair protection 300 Sq. Mtr. 3 ,200.00 9 ,60,000.00 properly.Thetileshallbedesignerinvariouscolors,textureetcasper thedirectionsoftheArchitectandwhereastheratetoincludelevelling whichshallbedonebyprovidingandlayinginpositionPCCofupto4" beneath the floor finishes whereverlevel difference is observed to attainauniformlevelallthroughoutthepremisesasperdirections& instructions of the Architect, underlay’s, adhesive etc complete.
The carpet shall be U.V resistant, wear resistant, have dimensional stability, anti-slip, stain proof, anti-shock, spill protection etc. The carpet tile shall be 100% synthetic woven ultrail nylon with antimicrobialprotection.Theotherpropertiessuchasgaugestitches, stain repellency, soil resistance, etc. shall comply with the carpet weight & shall be as per manufactures specifications etc complete.
(Basic rate shall be Rs. 180 / Sq. Fts).
h MR Anti static vinyl flooring: Electrical & UPS area, AHU room 15 Sq. Mtr. 1 ,345.50 2 0,182.50 Providing&fixingantistaticvinylflooring 2mmthkofapprovedshade inrollformincludinglevellingofsurfacewithPOPifanyonwhichitis to be applied AS PER INSTRUCTIONS OF Architect 179j False flooring for server room 25 Sq. Mtr. 5 ,623.95 1 ,40,598.75
11.54 Providing and fixing removable raised/false access flooring with Systemand its components ofapproved makefordifferentplenum height with possible height adjustment upto 50 mm, comprising of modularloadbearingfloorpanelssupportedonG.I.rectangularstinger frameworkandG.I.Pedestaletc.allcomplete,asperthearchitectural drawings,asspecifiedandasdirectedbyEngineer-in-chargeconsisting of:
(a) Providing at required spacing to form modular framework, pedestalsmadeoutofGItubeofthicknessminimum2mmand25mm outerdiameter,fullyweldedontotheG.I.Baseplateofsize100mmx 100mmx3mmatthebottomofthepedestaltube,G.I.pedestalhead ofsize75mmx75mmx3.5mmweldedwithGIfullythreadedstud16 mmouterdiameterwithtwoGIChecknutsscrewedonthestudfor leveladjustmentupto50mm,lockingandstabilizingthepedestalhead inpositionattherequiredlevel.Thepedestalsshallbefixedtothe subfloor (base) through base plate using epoxy based adhesive of approved make or the machine screw with rawl plug.
(b)Stringerssysteminallsteelconstructionhotdippedgalvanizedof rectangularsize570x20x30x0.80mmthickhavingholesatbothends forsecuringthestringersontothepedestalheadusingfullythreaded screwsensuringmaximumlateralstabilityinalldirections,thegrid formedbythepedestalandstringerassemblyshallreceivethefloor panel,thissystemshallprovideadequatesolid,rigidsupportforaccess floorpanel,thesystemshallprovideaminimumclearuninterrupted clearancebetweenthebottomofthefloorforelectricalconduitsand wiringetcallcompleteasperthearchitecturaldrawings,asspecified and as directed by the Engineer-in-charge.
(c)ProvidingandfixingAccessFloorpanelof600x600x32mmmedium gradeFilledSteelantistatichighpressureLaminationof800Hgrade
(FS800H).AccessFloorpanelshallbesteelweldedconstructionwith an enclosed bottom pan with uniform pattern of 64 hemispherical cones.ThetopandbottomplatesofSteelGauges: top0.6 mmand bottom0.7mmfusedspotweldedtogether(minimum64weldsineach domeand20weldsalongeachflange).ThepanelshouldbeCorroresist epoxycoatedforlifetimerustprotectionandcavityformedbythetop and bottom plate is filled with Pyrogrip noncombustible Portland cementitious core mixed with light weight foaming compound. The access floorshall be factoryfinished with Anti-static HighPressure laminatewithNonWarptechnologyupto1mmthicknessforsuperior adhesion and Surface flatness within 0.75mm. The panel is to withstandaConcentratedLoadof363kgsappliedonarea25mmx25 mmwithoutcollapseinthecentreofthepanelwhichisplacedonfour steelblocks.ThepanelwillwithstandandUniformlyDistributedLoad
(UDL)minimum1250kg/sqmandanimpactloadof50kgallcomplete as per the approved manufacturers specification and as per the direction of Engineer-in-charge. All specification must be printed on the side of the panel to ensure the quality of the product.
11.54.1 300 mm Finished Floor Height (FFH) 15 MR Pantry Counter Providing and erecting pantry counter 2'-0" wide pantry / kitchen counterwithcudappaundercarriageframe,11/2"thkwithoneside polished and top tobe finished with 18 mm thk high gloss mirror polishedblackpearlgraniteinthedesiredshape&sizeincludinghalf roundnosing&grooves.Theundercarriageframeofthecountershall 14 R.Mtrs 1 0,500.00 1 ,47,000.00 beinsandwitchcadappaverticalswithgranitefaciaofsize6"tobe fixedtoverticals andtop ofthe counter&nosingwith edgepolish including a cut-out for sink etc complete as per directions & instructions of the Architect.
Therateshallbeinclusiveofproviding&fixingmodularS.Sservice trolleys below with standard sliding channel sections as per manufacturersspecificationsforthecompletelengthandheightofthe counterincludingS.SSinkofniralimakeofsize24"X17"X8"including shuttersinmarineplywoodbeneaththeentirelengthofthecounter includingthenecessaryt.wframeandtobefinishedwithdecorative
1.5mmthklaminateandincludingnecessarywatersupply&drainage pipelines,plumbingfittings&fixturesofjaguarofapprovedequivalent makeetccomplete.Asperthedirections/tothesatisfactionofthe Architect.
16 MR ProvidingandFixingSyntheticDoormattingsystemofLG,Nomador equivalent make as per manufacturers specifications to match the 3 Sq. Mtr. 2 ,260.44 6 ,781.32 finished floor level in the adjoining areas 17 17 Sanitary Fittings & Fixtures ProvidingandfixinginpositionCPsanitaryfittingsofapprovedmake as follows.
180i MR European type water closet (EWC) a Supplying & Fixing in position White colored Wall mounted EWC (Approximate size 36X34.5X54.5cms) including its complete set of assessories such as CI brackets, 32mm dia flush valve or flushing cistern-flushtank(Incaseoftechnicalconstraintsininstallationof flush valve), water jet arrangement, M.S.chair - standard PVC seat cover,open/concealedtypecompleteincludingvaccumisolationvalve 1 Nos. 2 2,000.00 2 2,000.00 andalsoincludingplumbingbends,otherassessories,fittings,fixtures etccompleteincludingnecessarydrainageconnections(internalupto the external face of the building) including cPVC concealed water supply&drainagepipelineetccomplete.Make:CERA/HINDWARE/ PARRYWARE / JAQUAR / JOHNSON b 17.3 Providingandfixingwhitevitreouschinapedestaltypewatercloset
(Europeantype)withseatandlid,10litrelowlevelwhitevitreous chinaflushingcistern&C.P.flushbendwithfittings&C.I.brackets,40 mmflushbend,overflowarrangementwithspecialsofstandardmake andmosquitoproofcouplingofapprovedmunicipaldesigncomplete, includingpaintingoffittingsandbrackets,cuttingandmakinggoodthe
walls and floors wherever required :
17.3.1 W.C. pan with ISI marked white solid plastic seat and lid 11 Nos. 8 ,006.60 8 8,072.60 ii Flat back Urinals (With Sensor flush system)
17.5 Providingandfixingwhitevitreouschinaflatbackhalfstallurinalof size580x380x350mmwithwhitePVCautomaticflushingcistern,with fittings,standardsizeC.P.brassflushpipe,spreaderswithunionsand clamps(allinC.P.brass)withwastefittingasperIS:2556,C.I.trap withoutletgratingandothercouplingsinC.P.brass,includingpainting offittingsandcuttingandmakinggoodthewallsandfloorswherever
required :
17.5.1 Single half stall urinal with 5 litre P.V.C. automatic flushing 10 Nos. 1 2,071.75 1 ,20,717.50 cistern iii MR Wash basin 10 Nos. 2 1,200.00 2 ,12,000.00 Supplying&FixinginpositionWhitecoloredvitreousporcelainover thecountertypeoval/rectangularwashbasinfixedwithwhiteenamel paintedCI/MSBracketsincludingPVCflexibleconnection,rubberplug, 32mmdiaCPbrasswastecoupling,CPBottletrap,quarterturnStop CockandCPSwannecksensortypePillarCockwithCPwallflange, wastecouplingetccompleteincludingcuttingandmakinggoodthe walls wherever required including all its associated CP fittings includingnapkinringsofapprovedmakesaspersampleapprovedby theClient.Theratesshouldbeinclusiveofconnectingwatersupply& drainpipelines.Washbasinshallbeprovidedwithgranitecounterand therateofcountershallbeincludedinthequotedrate.Therateshall bealsoinclusiveofnecessarydrainageconnections(internaluptothe nahanitrap)includingdrainagepipelineetccomplete.Make:CERA/ HINDWARE / PARRYWARE / JAQUAR / JOHNSON 181iv MR Jet spray / health faucet 12 Nos. 1 ,550.00 1 8,600.00 Supplyingandfixinginpositionjetspray/healthfaucetforablutionfor WC in toilets of heavy quality com[complete with necessary fittings.
v MR Coat Hooks 8 No. 7 50.00 6 ,000.00 vi MR CP brass Liquid Soap containers 12 No. 1 ,000.00 1 2,000.00 vii MR ProvidingandfixinginpositionAskonmakeSingleBlowerStainless SteelSilentHandDryer,(H)265x(W)200x(D)115mm(Min)in 6 No. 1 6,000.00 9 6,000.00 Stainless Steel brush finish etc complete viii MR Providingandfixingmirrorpanelinginareasindicatedusing12mmthk Marineplybackingover6mmthk.'pre-approved'mirror,asspecifiedby Architects/Clients).Bevealededgefromallfoursides,Themirrortobe 35 Sq. Mtr. 3 ,230.00 1 ,13,050.00 fixedwithtwowaytapeof3Mmake,aspertheinstructionsofthe architects.
ix MR Providing&fixingExhaustFansinaluminiumframeincludingFrames 14 No. 1 ,550.00 2 1,700.00 for Exhaust Fans of appropriate size etc complete x MR Toilet Paper Holder 9 No. 1 ,200.00 1 0,800.00 xi MR Providing&fixingStainlessPaperTowelDispensersmallofsize(H) 203x(W)280x(D)102mm(Min)inStainlessSteel304ofapproved 10 No. 3 ,000.00 3 0,000.00 make such as Askon or equivalent etc complete xii MR Providing&fixingShoePolishMachineWithStainlessSteel,Powder Coated(StainlessSteel#304)SupportBar,220Vand75mmwidth, 2 No. 1 8,000.00 3 6,000.00 130 mm dia and Black color of Askon or equivalent approved make xiii MR Nahani trap with Jali cover 32 Nos. 7 00.00 2 2,400.00 ProvidingandfixinginpositionNahanitrapsof4"diaSizeapprox.with jali cover.
xiv MR Auto Janitors 8 Nos 2 ,000.00 1 6,000.00 xv MR PlumbingworkforAllPantry&Toilets(KindlyrefertotheLayout for details before quoting for the said Item) a Supplying,fixing,jointing,testingandcommissioningofapprovedmake ChlorinatedPolyvinylChloridepipes(CPVC)upto50mmdiaSDR11as perIS15778:2007&SDR11fittingsasperASTMD2846/D2846M- 14,bothofapprovedmake.,andabove50mmdiaCPVCSch80Pipesas perASTMF-441 &Sch80fittingsasperASTMF439-13,bothof approved make.. The fittings and specials such as tees, elbows, couplers,bends,enlargersetc.,withCPVCbrassthreadedcombination / transition specials such as male adapters brass threaded female 1 Lot 4 ,50,000.00 4 ,50,000.00 adapters, brass FPTTee, Brass FPTelbowetc., including necessary drillingholes,chasingwallsandmakingthesamegoodin asdirected by the Engineer in-charge. Joints.Wherever the pipes are crossing throughthewallspipesshouldhavesleevesinthewallandbetween pipeandsleeveshouldbesealedwithsiliconesealent.Annularspace betweenpipeandsleeveprovidedwhereverthepipesarecrossingthe wallwillbesealedwithglasswoolinbetween&firesealentcompound at either end.
Costshallbeinclusiveofallhangers,clamps,bracketsetc.shallbeof galvanizedironunlessspecifiedotherwiseandthensupplyofthesame shallalsobeincludedforratesunderthishead.Alsoratesincluding flusingandchemicalcleaningofpipes.ChargesforLabellingofpipeas percolorscheduleoverpaintedsurfaceofthepipes.Make:ASTRAL/ SUPREME / FINOLEX / ORIPLAST b Providing&fixing1/2"&1-1/2"G.I"C"classpipeordistributionin bothtoilet,pantryincludingchasefilling,coatofprimer/antirust 50 R.Mtrs 1 ,476.00 7 3,800.00 paintatalljoints,properpvcInsulationcoverforallpipesetc.thecost shall include all accessories c 18.8 Providing and fixing Chlorinated Polyvinyl Chloride (CPVC) pipes, havingthermalstabilityforhot&coldwatersupply,includingallCPVC plain&brassthreadedfittingsandfixingthepipewithclampsat1.00 mspacing.Thisincludesjointingofpipes&fittingswithonestepCPVC solventcementandthecostofcuttingchasesandmakinggoodthe sameincludingtestingofjointscompleteasperdirectionofEngineerin Charge.Concealedwork,includingcuttingchasesandmakinggoodthe walls etc.
i 18.8.2 20 mm nominal dia 700 Rmt 5 37.60 3 ,76,320.00 ii 18.8.3 25 mm nominal dia 29 Rmt 6 27.25 1 8,190.25 iii 18.8.4 32 mm nominal dia 54 Rmt 7 39.30 3 9,922.20 iv MR 40 mm nominal dia 30 Rmt 8 50.00 2 5,500.00 v MR 50 mm nominal dia 92 Rmt 9 75.00 8 9,700.00 18 MR Miscellaneous Works a Making trenches for raceways by cutting existing flooring/ walls, breaking the flooring & mortar and removal of debris.Providing 70 R.Mtrs 3 00.00 2 1,000.00 necessarybaseforracewayswith1:3:6P.C.C&fillingthetrenchwith 1:2:4 IPS with proper cement gutai & curing ,etc.
b P/ffrosted 12mmthktoughened glasspartitions withfulllengthL bracketcompletewithallaccessories. maxsize1200x700mm(asper 5 Nos 6 ,500.00 3 2,500.00 dwgs) c Providing&Fixing600mmwidecountersforanywork,washbasins, Serviceetcmadeof19mmthk.Graniteincluding300mmwidefacia supportedon25mmthkkaddapaincludingcuttingofholeincaseof washbasin counter, necessary drainage connection provisions 25 R.Mtrs 1 0,500.00 2 ,62,500.00 including edge polishing ofallexposededges &making cutoutsfor pillar cock, etc. as per dwg. Granite verticial support near basin counter.
182d Providing and erecting in position trap door in 12mm thk Marine Plywoodtohouse,A.C.ductableunitstobemadeoutof2"x11/2"t.w. framewithopenableshutterinplywithnecessaryhinges,towerbolts, 10 Sq. Mtr. 2 ,050.00 2 0,500.00 locks, painting etc. finished as per the instructions and design.
19 Modified Steelworkinbuiltuptubular(round,squareorrectangularhollow
10.16 &Tubesetc.)trussesetc.,includingcutting,hoisting,fixinginposition
10.16.2 and applying a priming coat of approved steel primer, including 190 Kgs 2 06.35 3 9,206.50 weldingandboltedwithspecialshapedwashersetc.complete.(Hot finished seamless type tubes) Rateshallincludeallasessoriesrequiredforerrectionetccomplete includingthreecoatsofenamelpaintofapprovedcolour&shadeetcas per standard technical specifications, instructions of Architect / Engineer-in-chargeonsite&codes.ItemtobeoperatedforanyCivil workswhereverdirectedincludingServicessuchasHVACmounting works 20 MR Providingandfixinginposition,plumbandline75mmthickfirerated partitionusing12mmthickgypsumboardononesideand9mmthk Promatect–HorequivalentapprovedCalciumSilicateBoardonthe otherside(Fireside)withGIsteelmetalstudframeofsize48/70mm thickusingfloorandceilingchannelsof50/72mmthickie.0.55mm thickandhavingequalflangesof34/36mmwithGIstud48mmthick i.e. 0.55 mm thick and have one flange of 36 mm placed @ every 600mmc/cmmintervals.Thejointsshallbefinishedwithjointpaper tapebyusingjointingcompoundandapplyingoverit3layersofthe 5 Sq. Mtr. 3 ,770.00 1 8,850.00 fillercompound,POPpunningasdirectedtoprovideasmoothsurface readytoacceptpaint.Therateshallincludethe3coatsofapproved acryllic emulsion paint including making cutouts for switch board, sockets,grilletc.forwhichnoextrawillbepaidseparately.Therate shall Include for preparing the surface smoothly and all as per manufacture's specification etc complete to the satisfaction of the Architect / Engineer in charge.
21 MR Supplyingandfixing HeavydutyStainlesssteel"L"angletobefixedto theedgesofColumns,StepsorwhereverdirectedbytheArchitectinSS 4 R.Mtrs 7 ,500.00 3 0,000.00
304.
SUM TOTAL OF SECTION A : - CIVIL WORKS Rs. 1 ,09,08,918.02 183SECTION B : - INTERIOR WORKS
GENERAL NOTES: - N.B: -The plywoodconsidered inthis estimateshallbeIS 303MR gradeCommercialPlywoodforalltheitems ofInterior&Furniture works.Therateshallbeinclusiveofantitermitecoatingonallsidesto plywood, teak wood & all the other wooden components of Asian paints or equivalent approved make.
Allinternalwoodwork / Plywood shall be treated with antitermite preservative. All internal framework shall be of Aluminium unless otherwisespecifiedasTeakwood.AIIexposededgesofPlywood shall befixedwithC.P.TeakLippingofsizeasdirectedbyArchitect.The skinning shall be in 303 MR grade Commercial Plywood unless otherwisespecified.Allexposedveneersurfacesshallbefinishedwith melamine / Polycoat / PU polish as directed. The thickness ofthe veneer shallbe 4.0mm&thatoflaminateshallbe1.5mmthk.The approved veneer shall be finished with naturalmelamine polish of minimum2coatstohavedesiredmattmelaminefinishwhereever specified.TheratesquotedfortheitemofPartitions&Panellingshall beinclusiveofproviding&fixinginbetweenthealuminiumframes, 50mmthkRockinsulSlabsofRockwoolIndiaLtdofdensity96kgs/ cu.mofstandardwidthaspertheavailablecleardistancesbetweenthe existingframesasdirectedwhereverrequired&instructedincluding above false ceiling framework.
Rate for full height partition to include the cost of framework above false ceiling as required to fix the same to the ceiling slab for which no extra payment shall be made and the rate quoted shall be inclusive of the same. Measurement of Partition & Panelling shall be limited upto the False Ceiling level. However the cost towards frameworks to be continued upto the main ceiling shall be deemed to have been considered in the quoted rates and no separate payment shall be made for the framework or supporting elements of partitions / panelling items, above the false ceiling level.
The rate shall be all inclusive of the necessary hardware, fittings, fixtures&includingglass&finishingforthesame.Therateshallbealso inclusiveofpattas&bands,groovesatanylevel,anydesigninveneer, texturesetcincludingthenecessaryframing/openingsforElectrical, Telephone&ACoutlets.FurtheritisimportanttonotethattheGlasses whereverspecifiedfortheitemsofPartitions&Panellingifanyshall havebevellededgesasperthedirection&thicknessasindicatedby the Architect or Engineer in charge TheratesquotedfortheItemsofPartitions&Panellingofany/all typesshallincludethe costtowards Providingand fixingadditional 75mmwidePattaoverandabovetheparticleboard/gypsumboardor any / all types of skinning provided for the items of Partitions & Panellingtobeprovidedin12mmthkMDFboardincluding3.0mmthk approvedVeneerwithhighend&highglossmelaminepolishincluding designer grooves etc complete as per the instructions and to the completesatisfaction.Nothingadditionalwouldbepaidonaccountof any pattas / bands provided for the said items.
50mmGlasswoolslabofdensity20kg/m³shallbeplaced inmetal framework.GlasswoolholdingclipshouldbeusedtoholdGlasswool slab in its position.
PARTITIONS / PANELLING
General Specification for partition :- Mainframe-Aluminiumsectionsof16Gaugementionedareoutofsize 2"x2" Aluminium section verticals at minimum 1' 6"-2'-0" Centre- Centrespacingapprox.and2"X1"sizeAluminiumsectionshorizontal at1'6"-2-'0"Centre-Centrespacingapprox.Extraframe belowslab soffitforconduittorunabove.Allverticalsshallbesecured tothe ceiling.
SKIN:-303MRgradeCommercialPlywoodshallbescrewedtoframe work on both sides with joints as shown or directed.
SKIRTING:Inthesamealignment,3"highin303MRgradeCommercial Plywoodwithagroovefinishedwithlaminate/veneeras thecase maybe, or as directed by the Architect.
Finishing :-
VENEER:-4mmthknaturalvennerwithmatchingsuperiorapproved gradetobefixedtotheplywoodhavingjointsasshownordirected complete with melamine polish finish.
LAMINATE:- Approved laminate shall be of 1.5 mm thick.
InternalLaminateshallbefixedonplywood skinswith gluehaving groovesasshownordirected.Internalsurfacesatspecifiedplacesshall be 0.8 mm thick as directed by Architect. The rates quoted for the items ofpartions&panelingshallbeinclusiveofproviding&fixingM.S.plate &brackets over &above the aluminiumframe work as directed & wherever instructed for mounting the TV units & screens etc complete.
184IMPORTANTNOTEONTHEDESIGNREQUIREMENTSAPPLICABLEIN CASEOFALLTHEITEMSOFPARTITIONS&PANELLING:-Thedesign&
the elevation of the various items under the heads: Partition & Panellingshallbeatthecompletediscretion&directions/instructions oftheEngineerincharge&Architectsonsite.Whereverinstructed& directed,therateshallincludeproviding&fixingadditional6mmthk plywood backing over and above the 303 MR grade Commercial plywoodsoprovidedintheitemsofpartition/panellingtoformraised paneldesignatregularintervalsasdirectedandtobefinishedwith highendapproved4.0mmthkveneerwithhighendmelaminepolish (proportion of gloss and matt as directed) with uniform shade & texture.Incaseof9mmthkplywoodusedinsteadof6mmthkplywood fortheraisedpanelsfortheitemsofPartitionorPanelingworks,the difference between the cost of 9mm thk plywood and 6mm thk plywoodfortheactualquantityofplywoodusedforthesaidpartition or panelling items shall be measured and paid.
The level difference between the said raised panels and recessed panels shall be finished with approved designer moulding to be finished with high end (proportion of gloss and matt as directed) melaminepolishandshallalsoincludedesignerinlaystobefinished withhighendveneerwithhighendmelaminepolish,pattas&bandsat variouslevelsetcinveneerandmelaminepolishandcombinationsof raisedandrecessedpanelswithinlaysetccompletetothecomplete satisfaction of the Architect and Engineer in charge.
ForallitemsofInteriorFurnishingworks&Furnitureworks,thebasic rate of Laminate considered for all the specifications / BOQ items hereinshallbeRs.65/Sq.Ftsplustaxes(GST)whereasthebasicrate ofVeneer,whichshallbehighend,uniformandwithoutanyvariations,
4.0mmthkconsideredforallthespecifications/BOQitemsherein shallbeRs.110/Sq.Ftsplustaxes(GST).BasicrateforFrosted/ Designer film of 3M, Llumar or equivalent approved wherever mentionedseparatelyshallbeRs.90/Sq.Ftsplustaxes(GST).The basicratewouldbetherateofferedtothebidderbythe vendor/ supplierafterdiscountsandexcludingthecosttowardstransportation, freight, loading, unloading etc and also exclusive of taxes (GST).
Necessary documentary evidence in the form of challans & Tax invoices,detailsofpaymentsreleasedtothevendorforthepurchaseof suchmaterials&includingtheloading-unloadingtransportslipsneeds to be submitted at the time of billing without which the payment processing shall not be entertained.
Further, Corian wherever mentioned in the BOQ (For items of Panelling, Reception Counter, Furniture elements etc) shall be high end, of desired and approved color and adhering to the BOQ specifications.Corianthicknessshallbe6mmthkforverticalsurfaces& fasciasand12mmthkforhorizontalsurfacesshallbeprovidedand withabasicrateofRs.1500/Sq.Ftsplustaxes(GST)for6mmthk Corian and Rs. 1800 / Sq. Fts plus taxes (GST) for 12 mm thk Corian.
1 PARTITIONS MR Providing and fixing Full ht. double skin Partitions as per specificationsincludingskirting,completeasperthedesign,drawings andinstructionsinallrespects.Thespecifications forthe saiditem shallcompriseofthefollowingandwithvaryingfinishesasmentioned
hereinunder: - FRAMEWORK -2"x2" Aluminium section of 16 Gauge verticals at minimum1'6"-2'-0"Centrespacingapproxand2"X1"sizeAluminium sectionshorizontalat1'6"-2'-0"Centrespacingapproxextraframe below slab soffit for conduit to run above. All verticals secured to ceiling.MeasurementofthesaiditemshallbeuptotheFalseCeiling level.
SKIN:-Bothsidewith12mmthk303MRgradeCommercialPlywood screwed to frame work on both sides with joints as shown or directed.
SKIRTING:Inthesamealignment,3"highin12mmthk 303MRgrade CommercialPlywoodwithagroovefinishedwithlaminate/veneeras the case maybe, or as directed by the Architect.
Therateshallincludeproviding&fixingt.w.beadingallthroughoutthe exposededges&periphery,sealingallthejoints,groovesinfinishes, melaminepolishtothemouldings&t.wmembers,completeasperthe directionsofArchitect.AllAluminiumsectionsshallbesmooth,rust free, straight, mitred and jointed mechanically.
Thefinishesfortheskinningtobescrewedtotheframeworkonboth the sides as duly mentioned above shall comprise of the following
types: - 50mmGlasswoolslabofdensity20kg/m³shallbeplaced inmetal framework.GlasswoolholdingclipshouldbeusedtoholdGlasswool slab in its position.
185Modeofmeasurementsforalltheherein-underItemsofPartitions& Panelling shall be strictly upto the False Ceiling level. Incase of differentiallevelsofFalseceilingonboththesidesofthepartition,the averageheightofthefalseceilingshallbetheheightforthepurposeof measurementsoftheItemofPartition.However,itmaybenotedthat fortheitemsofPartitions&Panelling,theframeworkofanynatureand asprovidedforthesameunderthespecificationsoftherelevantline itemsshallbecontinueduptotheRCCslab/beamasthecasemaybe andnoextra/additionalpaymentfortheframeworktobecontinued uptotheslab/beamshallbepayable.Incaseifthepartitionrequires skinningandtocontinueabovetheceiling,undersuchcircumstances andasperthedirectionsandinstructionsoftheArchitect,theItem shall be quantified under the relevant line item of the BOQ.
a MR Both side skins to be finished with 1.0 mm thk Laminate as shown in 66 Sq. Mtr. 4 ,000.00 2 ,64,000.00 drawing or as directed by Architect. b (i) MR Both side skins to be finished with 4.0 mm thk approved quality veneerfinishedwithhigh-endmelaminepolishasshownindrawingor as directed by Architect/ Engineer in-charge. (Quantityconsidered 200 Sq. Mtr. 4 ,500.00 9 ,00,000.00 hereinunderthisitemshallbepartitionwithsinglesurfacewithout any raised or recessed panels)
(ii) MR Bothsidefinishedinwith3.0mmthkapprovedhighendpremium quality veneer finished with high end melamine polish inbtween meetingroomandhallasshownindrawingorasdirectedbyArchitect. (Quantityconsideredhereinunderthisitemshallbeacombinationof raisedandrecessedpanelsofappropriatedimensionsandwith6mm 45 Sq. Mtr. 5 ,500.00 2 ,47,500.00 thkplywoodbackingfortheraisedpanelsincludingdesignermoulding attheedge/junctionofraisedandrecessedpanelsincludinghighend polishtothemouldingmatchingthepolishprovidedforthepanelsetc complete).
c (i) MR Bothsidestobedirectlyfinishedwithskinin12mmthkapproved Gypsum Board to be screewed directly to the Aluminium framing including POP Punning, levelling etc complete. Rate to also include Providing & Fixing Acryllic Emulsion Paint finish to the skin in coats of 80 Sq. Mtr. 3 ,890.00 3 ,11,200.00 desirednumberwithminimumoftwocoats.Rateshallalsoinclude providing grooves design in Gypsum as per the directions and instructions of the Architect.
(ii) MR Bothsidestobedirectlyfinishedwithskinin12mmthkapproved Gypsum Board to be screewed directly to the Aluminium framing including POP Punning, levelling etc complete. Rate to also include 5 Sq. Mtr. 5 ,500.00 2 7,500.00 Providing&Fixingapprovedwallpaperovertheskinsurface(Basic rate of Rs. 200/ Sq. Fts plus taxes {GST}) 186d MR Finishing:Bothside 6mmthkCalciumSilicateBoard/Hi-LuxBoard finishedwith3coatsofapprovedacryllicemulsionpaintincludingPOP punningforsurfacepreparation includingnecessarygrooves,skirting 3 Sq. Mtr. 3 ,950.00 1 1,850.00 etc complete as shown or directed by Architect.
e MR Oneside skinto befinished with1.5mmthkapproved laminate& othersideskinwith4.0mmthkapprovedqualityveneerfinishedwith 72 Sq. Mtr. 4 ,350.00 3 ,13,200.00 high-end melamine polish as shown in drawing or as directed by Architect.
f MR Finishing:Onesidefinishedin1.5mmthkapprovedlaminate&other with12mmthkapprovedGypsumBoardtobescreeweddirectlyto theAluminiumframingincludingpaintingwithPlasticEmulsionPaint 5 Sq. Mtr. 4 ,600.00 2 3,000.00 in minimum of three coats of approved make including necessary grooves, skirting etc complete as shown or directed by Architect.
g MR Finishing:Onesidefinishedin1.5mmthkapprovedlaminate&other with6mmthkCalciumSilicateBoard/Hi-LuxBoardfinishedwith3 coatsofapprovedacryllicemulsionpaintincludingPOPpunningfor 5 Sq. Mtr. 3 ,800.00 1 9,000.00 surfacepreparation includingnecessarygrooves,skirtingetccomplete as shown or directed by Architect.
h MR Finishing:Onesidefinishedin6mmthkCalciumSilicateBoard/Hi- LuxBoard&otherwith12mmthkapprovedGypsumBoardtobe screeweddirectlytotheAluminiumframingincludingpaintingwith 10 Sq. Mtr. 3 ,650.00 3 6,500.00 PlasticEmulsionPaintinminimumofthreecoatsofapprovedmake including necessary grooves, skirting etc complete as shown or directed by Architect.
j MR Finishing:Onesidefinishedin1mmthkapprovedlaminate&other with 25mm Accosutic Board with 0.90 NRC finished including 15 Sq. Mtr. 6 ,800.00 1 ,02,000.00 necessary grooves, skirting etc complete as shown or directed by Architect/ Engineer in-charge.
k(i) MR Finishing:Onesidefinishedin4.0mmthkapprovedVeneer&other with25mmAccosuticPETPanelBoardfinishedincludingnecessary 17 Sq. Mtr. 8 ,000.00 1 ,36,000.00 grooves, skirting etc complete as shown or directed by Architect/ Engineer in-charge.
(ii) MR Finishing:Bothsidesfinishedwith25mmAccosuticPETPanelBoard finishedincludingnecessarygrooves,skirtingetccompleteasshownor 75 Sq. Mtr. 7 ,500.00 5 ,62,500.00 directed by Architect/ Engineer in-charge.
l MR ProvidingandfixingFRAMEWORKin2"x2"Aluminiumsectionof16 Gaugeverticalsatminimum1'6"-2'-0"Centrespacingapproxand2"X 1" size Aluminium sections horizontalat 1'6"-2'-0" Centre spacing approxextraframebelowslabsoffitforconduittorunaboveincluding 12mmthkdesignerMDFboardonbothsidesincludingfinishingboth 32 Sq. Mtr. 4 ,950.00 1 ,58,400.00 sides with PU machine polish including all the necessary surface preparations, final finish etc complete of approved shade, colour & texture as shown in drawing oras directedbyArchitect, including necessary grooves etc complete.
m MR Providing & Fixing full height Semi-Glazed partition as per specifications including skirting, as per the design, drawings and instructionsinallrespects.Thespecificationsforthesaiditemshall comprise of the following and with varying finishes as mentioned
hereinunder: - FRAMEWORK-2"x2"Aluminiumsection of16Gauge verticals,not exceed 1' 6"-2'-0" centres and 2" X 1" size Aluminium sections horizontalatfloorlevel/skirtinght,3'-0"levelanddoorheightat7'-0" level. Allverticals securedtoceiling.Measurement ofthe saiditem shall be upto the False Ceiling level.
SKIN:-Bothsidesofthemainframeshallbefinishedwith12mmthk 303MRgradeCommercialPlywoodscreewedtotheframewithjoints asdirectedupto3'0"levelandfrom7'0"leveltothetopuptofalse ceilinglevelandincluding6mmthk.clearglassStraight/segmented withbevellededgesincludingfrostedfilmofapprovedmake&design anddrawingtobefixedwitht.wmouldingallaroundofapprovedsize &design including grooves, mouldings etc complete as directed by Architect & as shown in the drawing.
SKIRTING:Inthesamealignment,3"highin12mmthk 303MRgrade CommercialPlywoodwithagroovefinishedwithlaminate/veneeras the case maybe, or as directed by the Architect.
Therateshallincludeproviding&fixingt.w.beadingallthroughoutthe exposededges&peripheryincludingfixingtheglasswithstuds,sealing allthejoints,providinggroovesinthefinish,melaminepolishtothe mouldings&t.wmembers,completeasperthedirectionsofArchitect.
AllAluminiumsectionsshallbesmooth,rustfree,straight,mitredand jointed mechanically.
Thefinishesfortheskinningtobescrewedtotheframeworkonboth the sides as duly mentioned above shall comprise of the following
types: - i MR Bothsideskinstobefinishedwith3.0mmthkapprovedqualityveneer finished with high-end melamine polish as shown in drawing oras 25 Sq. Mtr. 5 ,200.00 1 ,30,000.00 directed by Architect. ii MR Both side skins tobe finished with 1.0mmthk approved Laminate 20 Sq. Mtr. 4 ,500.00 9 0,000.00 finished as shown in drawing or as directed by Architect.
187iii MR Onesideskintobefinishedwith1.5mmthkapprovedlaminate&other sideskinwith3.0mmthkapprovedqualityveneerfinishedwithhigh- 3 Sq. Mtr. 4 ,950.00 1 4,850.00 end melamine polish as shown in drawing or as directed by Architect.
iv MR Bothsidestobedirectlyfinishedwithskinin12mmthkapproved Gypsum Board to be screewed directly to the Aluminium framing including POP Punning, levelling etc complete. Rate to also include 5 Sq. Mtr. 4 ,350.00 2 1,750.00 Providing&FixingAcryllicEmulsionPaintfinishtotheskinincoatsof desired number 2 (i) MR Providing & Fixing in position FULL HEIGHT 100 MM thick PARTITION WITH DOUBLE LAYER GYPSUM ON BOTH SIDES - 30 Sq. Mtr. 3 ,400.00 1 ,02,000.00 50mm x 25mm x 1.6mm size over Aluminium FRAME WORK Partition from Finished flooring level till true ceiling level Framework Providing and fixing of 50mm x 25mm x 1.6mm size Aluminium partitionplacedat610mmcentretocentreinhorizontal&Vertical with joints staggered to avoid leakage through joints. has to be
provided at the horizontal joints of the two boards Provideanadditionalsalwoodmemberatthetrueceilinglevelandsub framesfordoorsandglazedopeningswhilefixingtheframeworkas per details Cladding / Skinning Theframeworktobeskinned/claddedonbothsides(tillthefalse ceiling)withDOUBLElayersof12.5mmthicktaperededgegypsum boardONBOTHSIDE(IS-2095/1982)inlineandlevelscrewfixedwith 25mm&35mmdrywallscrews@300mmc/cwithstaggeredjointsto avoidleakagethroughjointsandfinishedwithproprietarysupplied jointingtapetohaveflushlookwhichincludesfillingandfinishingwith jointing compound paper coat as per manufacturer's specification.
Jointstobesandpaperedtoachieveasmoothandseamlessfinish.Care mustbetakenthattheplasterboardsareraised3mmfromthefloor andinthisgap,cheekingcompoundisinjected,forsuccessivelayers and similarly for the true ceiling channel. Gypsum partition to be installed as per India Gypsum specifications.
Supply, Installation and Fixing 50mm thick glass wool of density 48kg/m3wrappedinRPTissues.Theglasswooltobefilled inthe cavity between the framework and Gypsum skins. Rate to include gluinginsulationtofirstboardatmultiplepointsandthenbracingthe insulation with the help of GI wires.
Special Provisions ContractortomakeprovisionforanyMEPServicesboxes/conduitsor othercomponentsinadditiontoelectrical/networkingrequiredinthe partitionandtoprovidediacut-outsasrequired.Electrical/Network boxes/conduits/orothercomponentsinadditionanyservicestobe
provided atdesiredheightandlocationasindicatedinthedrawing with Ply backing.
Thecostofgroovetobeincludedintherateofthepartitionforall junctions between materials, columns, walls, etc. to have necessary 6mm groove as per details ContractorstoprovideAtalllocationswhereservicesarepenetrating thepartitionabovefalseceilingtohavesalwoodframeworkaround theduct/cabletray/pipeandthegapsbetweentheframeworkand servicetobefilledwithappropriatefirestopmaterialasdirectedand also submit the DB level report after the works are completed
(ii) MR Same as above 'Item no. a' But STC 55 - Partition Providing and fixing 2 layers ofGypsumplasterboard (750kg/m3 densityfrombothside+2X50mmstudWith2X50mmthk 48kg/m3 Fiberglasswoolinsulation,10mmairgaps2layersof3mmor4mm 165 Sq. Mtr. 1 1,000.00 1 8,15,000.00 thicksounddeadeningmembrane,2layersof10mmthk.fibercement board (1400 kg / m3 density) 3 Full Height Fully Glazed partition A MR Providinganderectinginpositionfullheightfullyglazedpartitonin 12mmthk.toughenedglassfixedonPatchfittingsincludingtoppatch fitting,bottompatchfitting,patchlock,Floorspringofapprovedmake for the door and S.S handle 600mm long, 30mm dia for the door includingdesignerdecorativefrostedfilmofapprovedmake,shade& designontheglass.AlIdamagestothefloorworktobereinstated 10 Sq. Mtr. 5 ,200.00 5 2,000.00 withoutanyextracostincludingthecostofotherfittings&fixtures& hardwaresuchasspiderpanels,glasstoglasscontactorsetccomplete, necessaryholes,jointstobesealedwithsiliconesealantonallsides complete in all respects etc as per directions of Architect.
188B MR Providinganderectinginposition fullheightfullyglazedpartitonin 100mmx25mmKUBIKDG100Seriesorequivalentmakessuchas Saint Gobain / Liko / Ozone etc, AluminiumModular Double Glass Partitionusingstandardtracksectionofsize100mmX25mmsealand Slimindesign,thestandardpartitionsuitetobeusedwithanystud thicknessapprovedattop,bottomandsidesuptoanystudthicknessas permanufacturer'sstandardsandspecificationsandasdirectedbythe Architecttocomplywiththestandardpartitionsuitedesignincluding doubleglazed10mmthkcleartoughenedglass with10.52 mmthk laminatedGlasstobefixedwithintheframeincludingdoorframein the same matching Aluminium frame profile and for size to allow double glazed doors matching the Partition in terms of elevation, shape,size,thicknessetcasperdirectionsanduptoanydesiredheight of the partition as well as door, with sound insulation capacity of minimumupto49dBincludingGlasstoglassjointandconnectors,T- profile sections, sealants as per manufacturers standards including standard assessories as per manufacturers recommendations & standards,gasketsetccomplete.TheCleartoughenedglassshallbeof Saint Gobain / Asahi or equivalent make as approved including designerdecorativefrostedfilmofapprovedmake,shade&designon the glass Therateshallincludeprovidingandfixinginpositioncleartoughened doubleglassglazing(Partitionshallbemeasuredincludingthedoor withmatchingelevation,ifany,providedaspertheplan),10mmthk toughnedglasswithintheframeworkwith10.52mmthklaminated glass as provided in the partition-door system including necessary fitting, fixtures such as lock arrangement for the door as per manufacturersspecificationsandstandards,hinges,glassdoorhinge, coveprofile&skirtingetcaspermanufacturersrecommendations& standards. Style Door of standard sizes with door frame including hinges,doorlock,concealeddoorcloser&dropsealofapprovedmake forthedoorandS.Shandle450mmlong,22mmdiaforthedoor.All hardwaretobeofKubikorequivalentapprovedmakes.Ratetoalso includeprovidingandfixinginpositionfrostedfilmofapprovedmake, shade & design on the glass. All damages to the floor work to be reinstatedwithoutanyextracostincludingthecostofotherprofiles, hardware, assessories, fittings &fixtures &hardware etc complete, necessaryholes,jointsbetweendoor,glazedpartitionpanels(Glasses) tobesealedwithsiliconesealantonallsidescompleteinallrespects etcasperdirectionsofArchitect. Allexposedaluminiumsectionsare anodized aluminium finish with 6463 T6 Grade i DoubleGlazedPartition-Theglasspanelsshallbeaccousticproofand soundinsulatedandshallbeasperthemanufacturersspecifications 75 Sq. Mtr. 1 1,000.00 8 ,25,000.00 and standards.
ii SingleGlazedPartition-Sameasabove,howeverfullheightfullyglazed partitonin45mmx25mmKUBIK45{(45mmx25mm(singleglaze)} Seriesorequivalentmakes,AluminiumModularDoubleGlassPartition usingstandardtracksectionofsize45mmX25mmsealandSlimin design,thestandardpartitionsuitetobeusedwithanystudthickness 200 Sq. Mtr. 8 ,500.00 1 7,00,000.00 approved at top, bottom and sides upto any stud thickness as per manufacturer's standards and specifications and as directed by the Architecttocomplywiththestandardpartitionsuitedesignincluding double glazed 10mm thk clear toughened glass 4 MR Partitions above False Ceiling Providingandextendingframeworksoffullheightpartitionswherever directedandfinishingwith12mmthk303CommercialPlywoodon both sides and finishing the same with approved paint including insulatingthesamewithapprovedinsulatingmaterialuptosoffitof 40 Sq. Mtr. 1 ,995.00 7 9,800.00 beam or ceiling including properly anchoring the same making necessary cut-outs for AC ducts etc complete wherever directed.
5 MR LOW HEIGHT PARTITION A Providing&FixingLowheightPartitionofaboutheight4'-0"to4'-6" heighttobeerectedin2"X2"Aluminiumsectionof16Gaugeverticals withtheendverticalsonbothsidestohaveS.Spipe of2"dia,not exceeding1'6"to2'0"centresand2"X1"sizeAluminiumsections horizontalatfloorlevel/skirtinght,intermediatelevel&3'-0"level with12mm.thkBWP710MarinePlywoodskinonbothsidesofthe frametobescreewedtotheframewithjointsasdirected,including 12mm. glass with belevved edges of 1'0" to 1'6" height, including approved frosted film of approved make & design on the glass including 85 Sft 4 ,844.00 4 ,11,740.00 soft board white board panel with felt cloth on Bboth side ofthe partition.The2mm.thkBWP710MarinePlywoodskintobefinished with 4mm thk. approved veneer with melamine polish with t.w.
beadingallthroughouttheexposededges&peripheryincludingfixing the glass with studs, sealing all the joints, grooves in laminate, melaminepolishtothemouldings&t.wmembers,completeasperthe directions of Architect B MR Samespecificationsasitem3AabovebutLowheightPartitionfinished withapproved1.0mmthklaminatefinish,completeasperdrawingandas 10 Sft 4 ,090.00 4 0,900.00 directed by the Architect.
1895 PANELLING : - A (i) MR ProvidingandfixingWall&ColumnPanellingfortheexistingsurfaces tobemadeoutof16gaugeAluminiumframeworkbackingofsize2"X 1"at1'6"to2'c/cbothwaystobecoveredwith12mmthk303MR gradeCommercialPlywood andfinishedwithapproved4.0mmthk Veneerandmelaminepolishinanydesign,pattern,veneeralignment 205 Sq. Mtr. 4 ,200.00 8 ,61,000.00 etc including skirting & band at top in the same alignment with a grooveandincludingteakwoodmouldingofapprovedsizeasshownin detailed drawing or as directed by Architect
(ii) MR ProvidingandfixingWall&ColumnPanellingfortheexistingsurfaces tobemadeoutof16gaugeAluminiumframeworkbackingofsize2"X 1"at1'6"to2'c/ctobecoveredwith12mmthkexteriorgradePartical board and finished with high end exclusive & premium quality approved 3.0mm thk high end approved Veneer and high end melaminepolishincludingskirting&bandattopinthesamealignment withagrooveandincludingteakwoodmouldingofapprovedsizeas shownindetaileddrawingorasdirectedbyArchitectforMainHall 25 Sq. Mtr. 4 ,500.00 1 ,12,500.00 (Quantityconsideredhereinunderthisitemshallbeacombinationof raisedandrecessedpanelsofappropriatedimensionsandwith6mm thkplywoodbackingfortheraisedpanelsincludingdesignermoulding attheedge/junctionofraisedandrecessedpanelsincludinghighend polishtothemouldingmatchingthepolishprovidedforthepanelsetc complete) B MR ProvidingandfixingWall&ColumnPanellingfortheexistingsurfaces tobemadeoutof16gaugeAluminiumframeworkbackingofsize2"X 1"at1'6"to2'c/cbothwaystobecoveredwith12mmthk 303MR grade Commercial Plywood and finished with approved 1.0mmthk Laminateincludingskirting&bandattopinthesamealignmentwitha grooveandincludingteakwoodmouldingofapprovedsizeasshownin 225 Sq. Mtr. 2 ,850.00 6 ,41,250.00 detaileddrawingorasdirectedbyArchitect.{Itemshallbeoperatedon all surfaces including fixing above the storage units mounted on exterior walls within cubicles and as an partial enclosure to the exposed Glazing portion} C MR Providing&FixingdesignerapprovedAcousticPETPanelsPanellingof Techno,Tranquil,Continiumorequivalentmakeincludingapproved leatherite,satinorapprovedfabricofstandardwidthoverand25mm thk glasswool or soft board backing, total thickness as per 85 Sq. Mtr. 4 ,500.00 3 ,82,500.00 manufacturers specifications. The NRC to be minimum of 0.9. All around the panelling, decorative teak wood mouldings shall be providedandshallbefinishedwithmelaminepolishcompleteasper the instructions of Architect.
D ProvidingandfixingWall&ColumnPanellingfortheexistingsurfaces tobemadeoutof16gaugeAluminiumframeworkbackingofsize2"X 1"at1'6"to2'c/cbothwaystobedirectlyfinishedwithskinin12mm thkapprovedGypsumBoardtobescreeweddirectlytotheAluminium framingincludingPOPPunning,levellingetccomplete.Thefinishesfor
the said item shall comprise of the following: - i MR Providing&FixingAcryllicEmulsionPaintfinishtotheskinincoatsof 30 Sq. Mtr. 1 ,650.00 4 9,500.00 desired number ii MR Providing & Fixing Textured Paint finish finish to the skin 10 Sq. Mtr. 1 ,785.00 1 7,850.00 iii MR Providing&fixingapprovedcustomized/ready(Vibrant/thoughtful) wallpaperovertheGypsumsurfaceinpaneling, falseceiling orany surfaceasdirected.(Onlythecosttowardssupply&fixingofwallpaper 130 Sq. Mtr. 3 ,300.00 4 ,29,000.00 shall be quantified in this item. All other items including surface preparationshallbequantifiedunderrelevantitems).(BasicrateofRs.
200/ Sq. Fts + GST).
E MR Providing & Fixing Mirror Panelling using 6 mm thick mirror of approvedmakeover19mm710BWPgradeMarinePlywoodbacking.
The mirrortobe fixed with T.W beading of size 12.5mm X19mm, finishedwithmelaminepolishcompleteaspertheinstructionsofEIC. 10 Sq. Mtr. 3 ,500.00 3 5,000.00 Therateshallbeinclusiveofproviding&fixingS.Sstudsofappropriate size & diameter as directed including bevelling for the mirror F (i) MR ProvidingandfixingWall&ColumnPanellingfortheexistingsurfaces tobemadeoutof16gaugeAluminiumframeworkbackingofsize2"X 1"at1'6"to2'0"c/ctobecoveredwith12mmthk303MRgrade Commercial Plywood backing and finished with 4mm designer, 45 Sq. Mtr. 3 ,900.00 1 ,75,500.00 decorative MDF board including coats of duco paint of approved shade,colour&textureincludingteakwoodmouldingof4mmsizeall around the periphery as directed by Architect
(ii) MR ProvidingandfixingWall&ColumnPanellingfortheexistingsurfaces tobemadeoutof16gaugeAluminiumframeworkbackingofsize2"X 1"at1'6"to2'0"c/ctobefinishedwithCNCcutpanelsof4mmthk3D MDFdecorativepanelofanysize,design&patternsuchasopenjali, engravingetcandinanycolour&textureincluding necessarycove 10 Sq. Mtr. 4 ,200.00 4 2,000.00 lightingarrangementswithfrosted8mmacryllicsheetbackingtobe fixedusingteakwoodmouldingallaroundtheperipheryetccomplete as directed by Architect.
190G MR Providing & Fixing 6mm thk Corian for Partitions, panelling, False Ceiling, Tables, Furniture etc as perdirections forthe existing raw surfacessuchasplywood,particalboard,MDF,Aluminiumframework 20 Sq. Mtr. 5 ,850.00 1 ,17,000.00 etcincludingfinishingthecorianwithpolishofapprovedshade,colour & texture, frame etc complete as directed by Architect H MR Providing and fixing back-painted6 mmthk lacqueredglass tobe
provided for any type ofPartitions, Panelling, False Ceiling, Tables, Furnitureetcasperdirectionsfortheexistingrawsurfacessuchas plywood,particalboard,MDF,Aluminiumframeworketcdirectlytobe mounted overthe surface oroverand includingSS studsincluding 102 Sq. Mtr. 4 ,850.00 4 ,94,700.00 making provision for providing LED cove backlit lighting wherever directed,brackets,necessaryhardware,fittings,fixturesetccomplete asperthedirectionsofArchitect.Basicrateforbackpaintedglass/ muralic glass shall be Rs. 300 / Sq. Fts.
J MR ProvidingandfixingofWPCRafters/Louvers20-25mmthkforanytype of Partitions, Panelling, False Ceiling, Tables, Furniture etc as per directions for the existing raw surfaces such as plywood, partical board,MDF,Aluminiumframeworketcdirectlytobemountedoverthe surface or over including making provision forproviding LED cove backlit lighting wherever directed, brackets, necessary hardware, fittings,fixturesetccompleteasperthedirectionsofArchitect.Make- Reynobond/Reynoarch or equivalent. Rate shall be quoted for providingandfixinginpositionWPCRafters/Louversirrespectiveof theapplicationareai.e.Panelling,FalseCeiling orCladding andthe surfaceareai.e.footprintareaofthesameirrespectiveofthegrooves/ spacingbetweentheraftersorlouversintermsofSquarefeetsshallbe considered for the purpose of measurements and payment.
a 200mm x 2400mm 10 Sq. Mtr. 2 ,995.00 2 9,950.00 b 167mm x 2400mm 30 Sq. Mtr. 3 ,050.00 9 1,500.00 c 200mm x 2900mm 245 Sq. Mtr. 3 ,185.00 7 ,80,325.00 d 167mm x 2900mm 125 Sq. Mtr. 3 ,135.00 3 ,91,875.00 K MR SUPPLY&FIXINGinpositionwith100%WoolFeltTopAcousticPanels make 12mm (thk) forreducing and controlling Reverberated noise withaNRCof0.5mm,PanelComposition100%WoolonPETBaseto beminimum50%RecycledwithLOWVOCwhichaddresseslifecycle impactssuchasToxicity.Acousticboardtobefixedonabackingof 12mmthk.commercialplySizeofPanel1220x2400mm/2900mm 30 Sq. Mtr. 6 ,500.00 1 ,95,000.00 with thickness of 12mm , weight 2350gsm, Density 235 kg/m3.
AcousticNRC0.30forDirectFixingonWall,0.45witha14mmAirGap,
0.50witha24mmAirGap.lOWVOCANDGREENTAGCERTIFIED.To be used for Wall Panelling, Wall Screens and Ceiling Panels.
L MR SUPPLY&FIXINGinpositionof100%WoolCNCCutGroovedFeltTop Acoustic Panels make 12mm (thk) for reducing and controlling ReverberatednoisewithaNRCof0.5mm,PanelComposition100% WoolonPETBasetobeminimum50%RecycledwithLOWVOCwhich addresseslifecycleimpactssuchasToxicity.Acousticboardtobefixed on a backing of 12mm thk. commercial ply. Size of Panel 1220 x 10 Sq. Mtr. 7 ,850.00 7 8,500.00 2400mm / 2900mm with thickness of 12mm , weight 2350gsm, Density235kg/m3. AcousticNRC0.30forDirectFixingonWall,0.45 witha14mmAirGap,0.50witha24mmAirGap.TobeusedforWall Panelling, Wall Screens and Ceiling Panels.
6 DOORS i MR Solid Flush Door - 3'-0" x 8'-0" 12 No 1 9,500.00 2 ,34,000.00 ProvidingandfixingSolidCoreMarineFlushdoorshutters35mmthick ISImarkincludingproviding11/2"X1/4"and6mmthickTWlipping pattitoallexterior edges, 1.0 mmthk approved laminate finish of approved shade on both sides including 125X32mm Stainless steel hinges,heavydutyroundS.Scylindricallock,2Nos6"-S.Shandles,S.S door stopper, door closer, rubber bush and buffer etc complete as directedatsite.Therateshallbeinclusiveofproviding&fixing2nd classBTCframeofsize100X50mmincludingnecessarypolishingto the frame etc complete.
ii MR Solid Flush Door - 2'-6" x 8'-0" 9 No 1 5,250.00 1 ,37,250.00 ProvidingandfixingSolidCoreMarineFlushdoorshutters35mmthick ISImarkincludingproviding11/2"X1/4"and6mmthickTWlipping pattitoallexterior edges, 1.0 mmthk approved laminate finish of approved shade on both sides including 125X32mm Stainless steel hinges,heavydutyroundS.Scylindricallock,2Nos6"-S.Shandles,S.S door stopper, door closer, rubber bush and buffer etc complete as directedatsite.Therateshallbeinclusiveofproviding&fixing2nd classBTCframeofsize100X50mmincludingnecessarypolishingto the frame etc complete.
191iii MR Soliddoorwithglassvisionpanel/Louvers-3'-0"x8'-0"/2'-6"x8'- 2 No 1 7,550.00 3 5,100.00 0" ProvidingandfixingSolidCoreMarineFlushdoorshutters35mmthick ISImarkincludingproviding11/2"X1/4"and6mmthickTWlipping pattitoallexterior edges, 1.0 mmthk approved laminate finish of approved shade on both sides including 125X32mm Stainless steel hinges,heavydutyroundS.Scylindricallock,2Nos6"-S.Shandles,S.S door stopper, rubber bush, door closer and buffer etc complete as directedatsite.Therateshallbeinclusiveofproviding&fixing2nd classBTCframeofsize100X50mmincludingnecessarypolishingto theframeetccomplete.Therateshallbeinclusiveofprovidingand fixingwithinthedoor,visionpanelorlouversofsizeapproximately 300mmX300mmandwith6mmthkclearglassincludingwooden beading finished in 3 coats of melamine polish.
iv MR Fully Glazed Door - 3'-0" x 8'-0" 4 No 2 2,500.00 9 0,000.00 Providing&ErrectinginpoisitionFullyglazedSingleleafdoor&itsside fixedglassin12mmthkToughenedGlassonPatchfittingsofthesize 3'0"X7'0"eachincludingtoppatchfitting,bottompatchfitting,patch lock,FloorSpringofreputedmanufacturerandS.Shandle600mmlong, 30mmdiaincludingfrostedfilmofapprovedmake,shade&designon theglass.AlIdamagestothefloorworktobereinstatedwithoutany extracostincludingthecostofotherfittings&fixtures&necessary hardware, necessary holes, joints tobe sealedwith siliconesealant complete in all respects etc directions of Architect.
v Fire Door - Electrical Room a MR P/FfiredoorofMSSheetof1mmforDoor,MSSheetof1.2mmfor FrameConstructedtowithstand2hr.fireretardentwith ViewPanel size200mm X300MortiseLockwithpushdownhandle,DoorClosure fixedontopofthedoorFrameswillbefixedwithexpansionanchors 2 No 3 5,025.00 7 0,050.00 Colourofclientchoice-powdercoatedOverallshutterthicknesswillbe of 46mm standard size of the fire door 7' X 3' with Installation
b MR DoorFrame:WoodenDoorFrameofhardwood/teakwoodofsection withheatactivatedintumescentsealstripofsize10x4mmandone coat of Fire & anti-termite primer.
DoorShutter:AsbestosfreecompositeFire/Smokecheckshuttersof 60minutesfireratingconfirmingtoBS;476Part-22&IS:3614Part- IIcomprisingoftwo12mmthickCalciumSilicateboardssandwiching 12mmthickproprietoryfireresistanceinsulationMaterialfacedwith3 mm thick commercial ply facing on both sides with heat activated 1 No 3 5,025.00 3 5,025.00 intumescentfiresealstripsize10mmx4mmmountedinthegrooves onthreesidesexceptbottomwithViewPanelsize200mm X300and onecoatofanti-termitefireretardantprimer.Finishedwith1mmthick LaminatewithfireretardantprimerwithMortiseSashLockincluding DoorClosurefixedontopofthedoorwithCylinder–Completewith Lever Handle vi MR Main Entrance Door 3'-6" x 7'-0" 0 No 2 7,500.00 QRO P/F New Entrance Glass Door made out of 2nd class BTC 4" x 2" sections with Top, Bottom and Vertical members with 12 mm thk Toughened Glass, BTCmoulding, complete with approved matching LaminateColourZinkpolish,Handleofapproveddesign, P/FHeavy DutyFloorSpringof approvedmake,withallaccessoriesfortheMain EntranceDoor.ThecostincludestheMainDoorframemadeoutof 4"x2 1/2" 2nd class BTC Frame. Rest as per design, instructions.
Approx.Size :3'-6''x7'-0''.TheRateShallbeinclusiveofside12mm.
Thk.Fixedglasswith4”x2”BTCTop&Bottomsectionsasmentioned above with all standrad SS hardware accessories.
vi MR MAIN DOOR :
Providing&ErrectinginpositionFullyglazedSingle&/orDoubleleaf FullyGlazedMainEntrancedoorsofanysize&heightasperplan&as directedbytheArchitectincludingitssidefixedglassin12mmthk ToughenedGlassonPatchfittingsforeachofthedoorleafincluding top patch fitting, bottom patch fitting, patch lock, Floor Spring etc includingallnecessarhardware,fittings,fixturesetcofrecommended manufacturer such as Dorma or equivalent approved including S.S handle 600mm long, 30mm dia including frosted film of approved 20 Sq. Mtr. 7 ,000.00 1 ,40,000.00 make,shade&designontheglass.AlIdamagestothefloorworktobe reinstatedwithoutanyextracostincludingthecostofotherfittings& fixtures & necessary hardware, necessary holes, providing & fixing automatic acoustical drop seal on doors, joints to be sealed with silicone sealant complete in all respects etc as per drawings and directions of Architect.
7 MR Box for Rolling shutter Providinganderectingboxingtocovertherollingshuttertobemade outof19mmthk.303MRgradeCommercialPlywoodforcasingand openableshuttersbelowforservicingtobefinishedwithapproved4.0 25 Sq. Mtr. 3 ,100.00 7 7,500.00 mmthkexteriorgradeACPincludinghardwaresuchashinges,locks etc.complete as per instructions of Architect.
1928 MR Rolling Shutter a Providing and fixing new opaque rolling shutter with top box, channels, 38 Sq. Mtr. 3 ,250.00 1 ,23,500.00 locks, sliders etc complete as per site conditions. b Removing & refixing the existing rolling shutter, repairing the same, replacing the damaged sliders, channels etc including painting with 2 0 Sq. Mtr. 1 50.00 QRO coats of enamel paint etc complete.
9 FALSE CEILING
General :
The filler, paper tapes, finishes and primers suitable for Gypsum boards, shall be as per recommended practises of India Gypsum.
Frameworkgridandsuspendersshallbefixedtoavoidfoulingwith services such as ducting, sprinklers, electricals fixtures, etc T.W.framingmaybeallowedincertainareasfortheGypsumBoard ceilingwiththeapprovaloftheArchitect.Thesameshouldhavethree coats of fire resistant paint.
Note: All the hardware such as fastners, hangers, suspenders, etc. requiredforerectionofthefalseceilingshallbeofstandardapproved make & manufacturers specifications and approved by the Architect.
A MR Metal frame False Ceiling of 12 mm thk. Gypsum Board including 750 Sq. Mtr. 8 50.00 6 ,37,500.00 vertical drop panels.
Providing and Fixing 12 mm Thk. Gypsum board on metallic grid,
conformingtoIS:2095::1982.Themetallicgridshallconsistsofthe
following :
GlPerimeterchannelsofsize27mmand0.5mmthk.havingoneflange of 20mm and another flange of 30mm.
Glintermediatechannelofsize45mm0.5mmthk.Withtwoflangeof 15mm each at 4'-0" centre to centre.
Gl Hanger of size 1"x1", 0.5mm thk. A 4'-0" centre to centre distance.
Gl Cleat and Steel Expansion Fasteners.
Ceilingsectionof0.5mmthicknesshavingcurledwedgeof51.5mm andtwoflangesof26mmeachwithlipsof10.5mmat450mmcenterto center.Connectingclips&12.5mmdrywallscrewsat230mmcenter to center.
The metallic grid shall be installed as follows :
Theperimeterchannelalongtheperimeteroftheceilingwithscrew fixed to brickwall / partition with the help of rawlplugs and screws.
Theintermediatechannelsshallbesuspendedfromtheceilingwith steelGlhangerfixedtotheslabsoffitwithGlcleatandsteelexpanation fasteners.Theintermediatechannelsshallbeat4'-0"centretocentre distance.
The ceiling section placed in a direction perpendicular to the intermediate channel at 1'-6" C/C distance shall be fixed to the intermediatechannelwiththehelpofconnectingclipsand12.5mm dry wall screws at 230 mm centre to centre distance.
Finally, the 12mm thk. Gypsum boards shall be fixed to the metal framesandthetapered/squareedgesoftheboardsshallbefinishedto a flush joint with requisite filler, paper tapes, finisher and primer suitable for Gypsum plaster boards, (as per recommendations of manufacturers, Indian Gypsum or equivalent) including Acrylic Emulsion Paint of approved make and shade and colour.
Therateshallincludethecut-outstobemadeforlightfittings,grills, diffusers,speakers,smokedetectors,sprinklersetc.withprovisionof theframealongperimeterofthecutouts/openingwithchannels/ply tosupporttheceilingadequatelyasperthedirectionsofArchitect.The rate shall include necessaryshapes, designs, patterns in curvature, sloping, dome, oval & eliptical shaped etc including the necessary provisionsofcovedlightingschemeetccompleteasperthedesigns, drawings and instructions of the Architect.
B Mineral Fibre Board False Ceiling ProvidinganderectingfalseceilingofMineralFiberceilingBoardof approvedmakewithframework,runners,crossrunners&suspenders from the existing ceiling as per the manufacturers details and specificationand600X600mmX15mmthktilesofapproveddesign, texture &inmicrolook patternincluding thegrids inblack /white silhouttepattern,15mmaspermanufacturersspecificationscomplete includingmakingnecessarycut-outsforelectricalfixtures,ACdiffusers, access etc as per the instructions of the Architect.
(i) MR Approved preminum Tile in Dune RH Microlook or equivalent approvedcategorywithblacksilhouettelockingsupportingsystem,15 mmgrid.TherateshallalsoincludeProviding&Fixinginposition50 mm high Axiom with all its associated Accessories as per manufacturersspecifications&standardsetccomplete.Ratetoalso 125 Sq. Mtr. 1 ,200.00 1 ,50,000.00 includeproviding&fixingadditional6mmthk.commercialplybacking on mineral fibre modular false ceiling tiles of support light fitting, speakers, CCTV cameras in grid work wherever directed 193(ii) MR ApprovedpremiumTilein19mmthk.finefissuredhighAcoustictile boardwithaminimumNRCof0.95,ClassI(ClassA)fireratingwith blacksilhouettelockingsupportingsystemlockingsupportingsystem, 15mmgridetccomplete.TherateshallalsoincludeProviding&Fixing inposition50mmhigh AxiomwithallitsassociatedAccessoriesasper 20 Sq. Mtr. 2 ,800.00 5 6,000.00 manufacturersspecifications&standardsetccomplete.Ratetoalso includeproviding&fixingadditional6mmthk.commercialplybacking on mineral fibre modular false ceiling tiles of support light fitting, speakers, CCTV cameras in grid work wherever directed C MR ProvidinganderectingFalseceilinginWPCFlutedPanels/Bafflesof woodentexturewithSizeshallbe40-50mmx100mm(WxH)&shall haveaminimumof25mmtomaximumof100mmGapasperdirections &instructionsfromtheArchitectonsite,includingallaccessoriessuch as hanging arrangement, screws and other accessories, hardware, fittings,fixturesetcincludingfixingthesametothemainRCCceiling 300 Sq. Mtr. 3 ,850.00 1 1,55,000.00 withfasteners,clamps,necessaryfittingsetccomplete.Allsuspended hanger, clips, unigrid channelshallbe Galvanised mild steeland of approvedcolorofthebafflesincludingtheinstallationwhichshallbe done as per manufacturer’s specification.
Thepanelsshallhavedimensionalstability,longevitywithresistance to rot and crack and all technical features as per manufacturers specificationsandstandardswithstabilityoverawidetemperature range,weatherresistant, Moistureresistant, firerated, Highimpact resistant, Outstanding screw and nail retention, Environmentally friendly,recyclableandcontainingnotoxicchemicalsorpreservatives etccompleteasperlateststandardsandguidelines.(Quantificationof thePanelsshallbedoneintermsoftheSq.Ftsareacalculatedinand over the Plan view i.e. overall footprint area of the panels) D MR Providing&Fixinginposition100mmx50mmPlainAcousticsBaffles/ Battens/PETPanelsceilingforfalseceilingmadeof100%PETfibres wrapped with 2mm PET felt of min thickness 27mm having impregnatedboltsforhangingvertically fromceiling achieving0.95 NRC(PETPolyester Acoustic Panels shallbe acousticallyabsorbent panelsmadefrom100%PETplasticwithafelt-likefinish).Nominal sizeofpanel1500longx200mmhighx30mm.Boltssupportedfrom ceiling using SS wire of min. 1mm dia. Each baffle must be hung verticallyusing2suspensionboltsonlyandlevelledinperfectplane.
Workshallbecompleteinclusiveofallfittings&hardware.Colorshall 170 Sq. Mtr. 4 ,650.00 7 ,90,500.00 beasperArchitectapproval.Rateshallincludeallaccessoriessuchas hangingarrangement,screwsandotheraccessories,hardware,fittings, fixtures etc including fixing the same to the main RCC ceiling with fasteners, clamps, necessary fittings etc complete. The panels shall havedimensionalstability,longevityandalltechnicalfeaturesasper manufacturers specifications and standards. (Quantification of the PanelsshallbedoneintermsoftheSq.Ftsareacalculatedinandover the Plan view i.e. overall footprint area of the panels) 194E MR Wooden Ceiling finished with 4mm thk Veneer 50 Sq. Mtr. 7 ,300.00 3 ,65,000.00 Providing and erecting false ceiling in veneer in any shape, design, pattern such as battens, curvature, sloping, dome, oval, suspended dome,cylinder,inverteddome,elipticalshaped,battens&anyother shapeasdirectedorinstructedetcincludingthenecessaryprovisions of coved lighting arrangement etc complete as per the designs, drawingsandinstructionsoftheArchitecttobeprovidedwith12mm thkCommercialplybackingonteakwoodframetobeanchoredtothe mainceilingwithcrossrunnerstonguedandgroovedincludinganchor fasteners,crossbracings,bracketsetc.Plytobefixedtotheteakwood frametobefinishedwithapproved4mmthkhighendpremiumclass veneer&highendmelaminepolishetccompleteasperdirectionsof the Architect.
F MR Providing&FixingDesignerStretchfabricceilingtranslucentbacklit systemforReceptioncircularceilingsuspendedlogoofDia-3000mmX 100mmht.finishwithallnecessaryplysupport,boxing,hardwareand 25 Sq. Mtr. 1 2,500.00 3 ,12,500.00 accessories,LEDlights.Asshownin3dviewanddwg.andinstructed by architect.
G MR Providingandfixingwoodenceilingwithframeworkin50mmx35mm approved seasoned hardwood section @ 600mm c/c both ways suspendedfromRCCslab.12mmPlyshallbefixedtotheframework and 12mmthk.acousticpetpanelwithCNCgrooved,Includingside verticalof100 x150 mmas perdrawings. Top ofthe paneltobe treated with anti-termite treatment and finished with 1 coat of 10 Sq. Mtr. 1 3,500.00 1 ,35,000.00 approvedcolourpaint.Ratetobeinclusiveofallkindsof profilesand cut outs required for light fixtures, Speakers, Smoke detector, trap doors and AC grill in the ceiling. Wooden framework as per requirement&150mmdepthwithcoveprovisiontobeconsider.Plan area to be considered for measurement, verticals will not be paid separately.
H MR Providing &fixing ofCeiling Baffle Pet Panels. The Shape, Size and thickness can be customized as per Architects directions and requirement.(RatesareincludingHardwareandInstallation)Itwillbe 80 Sq. Mtr. 3 ,500.00 2 ,80,000.00 fixed on Thread Bar and C Channel Suspension System. Size - 24mm(thk) x 100mm(h) x 2400mm(l) & fixing at 200 mm c/c I MR Providing & Fixing of Ceiling Clouds (Shapes) The Shape, Size and thickness can be customized as per Architects directions and requirement.(RatesareincludingforCloudsand4SetsofWireRope HangingHardwarewithInstallation)ItisToBefixedonWireRopes.
Support Stiffner to be considered.
(i) Size : 1200mm x 1200mm x 24mm(thk) 50 Nos 7 ,000.00 3 ,50,000.00
(ii) Size : 2400mm x 600mm x 24mm(thk). 20 Nos 9 ,500.00 1 ,90,000.00 10 MR Providing&ApplyingPlasterofParisPunninguptoaveragethickness of12mmthk.on existingwalls toproper level&plumb,including 775 Sq. Mtr. 4 35.00 3 ,37,125.00 Groove Complete as per site conditions & directions of the Architect.
11 MR ProvidinganderectinginpositionPlasterofParisCornices3"x3"in sizetothefalseceiling.IncludingfillingthegapswithPOP&painting 335 R.Mtrs 2 00.00 6 7,000.00 thesamewithAcryllicEmulsionpaintofapprovedcolourandtexture as per instruction of Architect.
19512 PAINTING :
Note : The Rates for the Painting works shall be inclusive of three coats.
The paint should be free from lead and Arsenic.
A MR Painting of wall with minimum of 3 coats with Lustre Paint of approvedshade&makeonthewall,plywoodorgypboardincludingall necessarysurfacespreparation,scrapping,basecoatsetctoreceive3 coats.Thewallshallbecleaned,filledwithputty&appliedwithone 70 Sq. Mtr. 2 70.00 1 8,900.00 coatofprimersoastoachieveaevensurfacetoapplypaintasperthe directions / to the satisfaction of the Architect.
B MR Providing and applying acrylic aggregate textured wall coating of AsianTextured&SpecialEffectsPaint,DuluxAmbianceorequivalent approvedinanyshadesprayandapprovedtexturecoat,pebble,ripple, linea, marble, slate, special effects suzh as zig-zag, bloom, bubble, compact, rustik shade etc or as approved including base coat, maintaining material consumption rate as per manufacturers 100 Sq. Mtr. 1 ,200.00 1 ,20,000.00 standards&specificationsanduptoanydesiredthicknessonwallsto thecompletesatisfactionoftheArchitect&Engineerincharge.The rateshallincludePOPpunningtothewalluptoaveragethicknessof12 mmtoproperlevel&plumbincludingscrapping,basecoatsasper manufacturers specifications, cleaning of the walls etc complete.
C MR ProvidingandapplyingRoyaleEmulsionPaintinminimumofthree coatsofapprovedmakeandshadeonWalls,Ceiling,plywood,gypsum board,surfacesetcincludingallthenecessarysurfacespreparation, POPpunningtothewalluptoaveragethicknessof12mm(Including costtoincludePVCcornerprofilesasperdetails)toproperlevel& 750 Sq. Mtr. 3 85.00 2 ,88,750.00 plumb, including grooves, primer coat, sanding etc scrapping, base coatsetctoreceive3coatsofpaint.Thewallshallbecleaned,filled withputty&appliedwithonecoatofprimersoastoachieveaeven surfacetoapplypaint.Asperthedirections/tothesatisfactionofthe Architect.
D MR Flat Oil Paint 15 Sq. Mtr. 3 50.00 5 ,250.00 Paintingofwallwithminimumof3coatsofFlatOilPaintofapproved shade&makeonthewall,plywoodorgypboardincludingallnecessary surfaces preparation. The wallshallbe cleaned, filled with putty & appliedwithonecoatofprimersoastoachieveaevensurfacetoapply paint. As perthe directions / to the satisfaction ofthe Architect / Engineer in charge.
E MR ProvidingandApplyingTexturedpaint,Oikosordulyapprovedshade asperManufacturersspecifications.Therateshallbeinclusiveofthe surfacepreparationofthewall/panelling/partitionstobesmooth andinline,level&plumbwithPOPPunningandtoreceivethreecoats 7 Sq. Mtr. 1 ,200.00 8 ,400.00 of approved color paint finish with protective coat of CERA PER RAFFAELOaspermanufacturersspecificationsandasdirectedbyEIC.
(Basic rate @ Rs. 90 / Sq. Ft.).
13 Blinds i MR Providing&Fixinghighend&premimclassRollerBlindsofapproved make with supporting framework etc of approved shade & colour, opaque eclipse type complete inallrespects &working orderwith triple spring arrangement as per manufacturers specifications & standards&directionsoftheCompetentAuthority.Thecosttowards 185 Sq. Mtr. 1 ,400.00 2 ,59,000.00 automation &automatic motorized openings shallbe considered in automationestimates,howevertherollerblindsinstalledshallhave provision for synchronization to automation system. (Basic rate of Roller Blinds shall be Rs. 120 / Sq. Fts plus taxes {GST}) ii MR Providing&Fixinghighend&premimclass antiglareMotorizedRoller Blinds with in-built Automation of approved make with supporting framework etc of approved shade & colour, opaque eclipse type complete in all respects & working order with suitable mounting arrangement as per manufacturers specifications & standards & directionsoftheCompetentAuthority.Therollerblindsinstalledshall have provision for synchronization to automation system including 20 Sq. Mtr. 1 1,000.00 2 ,20,000.00 providingandfixingmotorsofappropriateHPcapacity.Thecontractor to prepare shop drawings in consultation with the manufacturer & auto- controlagencyandsubmitthesameforpriorapprovalandexecution.
(BasicrateofRollerBlindsshallbeRs.200/Sq.Fts.Automation& motor control shall be in built in the quoted rate) iii MR Providing & Fixing Vertical Venetian Blinds 4" wide of'approved make,shade,textureintwocolourswithsupportingframeworkand assemblycompleteinallrespects&workingorderwithtriplespring 10 Sq. Mtr. 9 70.00 9 ,700.00 arrangement as per manufacturers specifications & standards & directions of the Competent Authority.
19616 (i) MR Providing&Fixingfullheightdisplaystorageunitwith12mmthkglass shelvesandglassshutterswhereverdirectedonheavydutymagnetic catchincludingprovisionforwarmlightingarrangementtobemade insideatthestoragetoppanel.Allexposedsurfacestobefinishedwith
3.0mmthkhighendveneerwithmelaminepolishetccompleteand 10 Sq. Mtr. 1 0,225.00 1 ,02,250.00 internalexposedsurfacesshallbefinishedwith3.0mmthkapproved highendveneerwithmelaminepolishincludingheavydutyhardware, fittings, fixtures etc complete to the complete satisfaction of the Engineer in charge & Architect.
16 (ii) MR Finishing:-Do-SamespecificationsasabovebutfortheLockerunitsof thestaffincludingpigeonholesandthefrontofthepigeonholestobe providedwith25mmlaminatedplyincludinglocks,hinges,handles, 5 Sq. Mtr. 5 ,600.00 2 8,000.00 necessary fittings and internally surfaces to be polished etc complete.
17 MR Aluminium Single Glazed Window (Exterior Side) 200 Sq. Mtr. 3 ,200.00 6 ,40,000.00 ProvidingandfixingAluminiumAnodisedSlidingWindows3/4-track AlluminiumAnodizedwindows.Theframeshouldbe2"x11/2"wide
section with tracks on all the slides and drain traysystem for the bottomframe.Theshuttersshouldbeofsuitable2"x1"sectionfortop and bottom member and 1 5/8" x 1" for vertical with 6mm. thk.
Modiguard/SaintGobainmakeclearfloatglassandimportedbearings shallbeused.thetrackwillbefixedon2"x1"alluminiumpipeframe.( HeavyDuty2"thk.frame(14gauge)ofJndal/Indal/Hindalcoco. make)Rateshallbeinclusiveofnecesaryfittings,locks,handles,best quality rollers, necessary hardware items etc. complete
Note:Aluminiumframe,sashandmullionprofilesminus5%tolerance in dimension i.e. in depth & width of profile shall be acceptable.
Variationinprofiledimensioninhighersideshallbeacceptedbutno extra payment on this account shall be made.
Providing and fixing 6 mm thk glazing (Glass) of Saint Gobain or equivalent including filling the gap in between with Siliconsealent includingthenecessaryfittings,hardwareandpanelsandasperthe manufacturers specifications and directions and instructions of the Architect or the Engineer-In-Charge.
18 MR Aluminium Louvered Window Providingandfixingpowdercoatedaluminiumlouveredwindowwith
5.5mmthktintedglassandlouveredglasspanesinaluminiumwindow sections with proper locking arrangement, heavyduty channels for smooth movements including provision forfixing ofexhaust fan by 45 Sq. Mtr. 3 ,500.00 1 ,57,500.00 providingfixedglassinalumniumsectionaboveincludingapproved sun control film etc. complete as per instructions of Architect.
19 MR Miscellaneous General Works a Providing and fixing running counters at locations indicated on the drawingstobefabricatedoutof19mmthkcommercialplyandfinished in1mmthk.Laminateofapprovedshadeandcolor.Thetablewidthto be average 2'-0". The counters to have vertical supports for fixing shutters fabricated out of 19mm thk commercial ply finished with 2 R.Mtrs 9 ,185.00 1 8,370.00
1.0mmthk.laminateexternally& internally.Theshuttertobefixed with SS hinges complete with all necessary hardware like handles, locks etc of approved make as per design and detail. b Providingandfixing5"widePelmetwith18mmthkBWP710Marine Plywoodincludingt.wlippingsonalledgesoftheplywoodandfinished onbothsidesetccompleteaspertheinstructions-Finishedin4.0mm 60 R.Mtrs 1 ,883.00 1 ,12,980.00 thk approved veneer with melamine polish on both sides c Supply&Installationof3MClearviewDecorwithapprovedartwork digitally reproduced with water-based inks certified to have no hazardous air pollutants. Self-adhesive, optically clear, bubble-free 150 R.Mtrs 8 20.00 1 ,23,000.00 installationtobedoneoncleanglass,byAuthorizedInstallersonly.3M interiorwarrantyforaperiodof3yearstobesubmittedalongwith invoice by 3M directly to customer.
d Supply&Installationof3MEnvisionWrapNon-PVCWallDécorPro whereinEnvisionWrapLX480Cv3willbeusedasabasematerialfor printingand8550MwillbeusedasaOverlaminatetoprotecttheprint fromfading,whichwillcomeinamattefinishwithapprovedartwork digitally reproduced with water-based inks certified to have no hazardousairpollutants.Self-adhesive,bubble-freeinstallationtobe 52 Sq. Mtr. 3 ,565.00 1 ,85,380.00 doneonasmooth,dustfreeputtysurfacethathasacoatofoil-based primer,byAuthorizedInstallersonly.Certificateofimagelicenseand 3MInteriorWarrantyforaperiodof5Yearstobesubmittedalong with invoice. Base preparation to be included.
197e Providing&FixingglassshelfsonbracketsinVCandmeetingroomsin 3 Sq. Mtr. 3 ,230.00 9 ,690.00 12mm thk. Glass on D-brackets / Studs f Providing&FixingDesignerStretchfabricceilingtranslucentbacklit systemforReceptioncircularceilingsuspendedlogoofDia-3000mmX 100mmht.finishwithallnecessaryplysupport,boxing,hardwareand 3 Sq. Mtr. 1 5,000.00 4 5,000.00 accessories,LEDlights.Asshownin3dviewanddwg.andinstructed by architect.
g ProvidingPestControl&AntitermitetreatmentbySpecializedagency 1050 Sq. Mtr. 1 85.00 1 ,94,250.00 as per the approved specification. h Providing&installationofNaturalPlantswithbasicpotstobeplaced insidethecontainerboxes.AllpotswillbewithPot-in-Potmechanism ORBaseplatestoavoidwaterleackage.LecaballsforTopdressing, 75 Nos 1 ,500.00 1 ,12,500.00 Fillers to raise the height etc complete including digital meters, thermometers, humidity meters, gauges etc complete I (i) Providing&installationofGardenPlanter(Pot)FRP(FibreReinforced Plastic)Size-14"x24"(WithselfcontainedStand)etccompleteasper 30 Nos 9 ,000.00 2 ,70,000.00 manufacturers specifications and standards
(ii) Providing & installation of Natural Indoor Plants - Healthy & Bushy Plant (as per mockup / Images) - Potting Soil, Compost & Coco-peat for plantation 30 Nos 3 ,000.00 9 0,000.00 -PlantVarietiesetccompleteincludingdigitalmeters,thermometers, humidity meters, gauges etc complete j PhotoFramesArtwork-Providingandfixingartworkpaintingasper selection,approvalandinstructionsbytheArchitect.BasicRateofthe 5 Nos 1 5,000.00 7 5,000.00 artwork with frame to be Rs. 10,000/- per piece k Vibrant Lounge Seatings as per Layout Lounge chair - Type 1
inner : 40% density Moulded foam shell 3 Lots 5 5,000.00 1 ,65,000.00
Base: Solid Beech Wood upholsteryasperselectedshadeofFabricfinish(BasicrateofLot:Rs.
45,000/-) l Signages Lot 1 3 ,75,000.00 3 ,75,000.00
(Lumpsum) Supply & Fixing of Signages comprising of the following broad-line specifications for a. Information Signs : size - 1200x 300 mm b. Room Name Sign (With Code) : size - 250 x 250 mm / 500 x 250 mm c. Cabin Name Sign : Size 500 x 100 mm d. General Utility Sign e. Prohibition, warning & Mandatory sign : Size 600 X 150 mm f. Door Signage PUSH PULL etc complete g. Safety Signes, Emergency, Fire, Evacuation etc Sign Face Shallbemadein18gaugethickBrushfinishedSSsheetprofilecutto matchshapeasperdrawings,fixedtoframe(bothside)using3MVHB tape on the horizontal sides of the panel, as per approved sample.
Sign Frame Providing and fixing sign frame in 25mmX25mmAluminiumsquare sectionpowdercoatedinBlackasperdrawing.Frametobedirectly fixedtothetrueceilingandshouldmatchwiththeleveloffalseceiling.
Frame to receive the sign faces.
Text Providingandpastingalltextinplottercutopaquecastvinylasperthe specifiedblackcolorandcontentgivenforeachlocationforeachface. >> Graphics Providing and pasting all Graphics in opaque cast vinylas per the specified light blue/grey (as approved) color
Accessories:Providingandfixingallaccessoriessuchasthimbles,end connectors, nut-inserts, screws , rivets, bolts, washers, nuts, etc. complete as per drawings etc complete m Decorative Accoustic Lighting Fixtures i Supply &Installation ofDecorative type (Chandelier) Light fixtures
(LEDtypepreferably)onlyforReceptionArea(Total=1no.s).Basic costofperlightfittingincludinglampshallbenotbemorethanRs.
8,000/-(Inclusiveofalltaxes,duties,etc.).Thefittingshallbehanged fromthe ceiling at the required height alongwith required support 1 LS 1 0,000.00 1 0,000.00 arrangements fromthe ceiling including allneecessary hardware & accessories, etc. complete as required, directed &approved by the Architect / Client / Consultant.
198ii Supply, Installation, Testing&CommissioningofDecorativeIighting Fixtures - Dovetailed Suspended Acoustic Absorption system with designinsize900mmdiameterx12mm(thk)madeoutofthermally bonded polyester containing not less than 50% recycled material.(BaffleModuleswillbesuppliedinaknockdownstateandis tobeassembledatsite)inapprovedColourwithSoundAbsorption 5 NOS 1 0,000.00 5 0,000.00
0.75to0.85NRCtobefixedtoceilingusingspecialfittings,fixturesetc, Fire Rating ASTM E-84-16: Class A. Rates to include hardware (Hardwareincludesclampingbrackets,Clutchwiresystemswithend cableadjustersincludingsuspenders,hangersetc)etccompletetothe satisfaction of the Architect & Engineer in charge.
iii Supply, Installation, Testing&CommissioningofDecorativeIighting Fixtures - TAPER GROOVED Designer Acoustic Lighting fixture, fabricatedfrom12mmPrism/ChromaSeriesAcousticPanelsCladded 5 NOS 1 5,000.00 7 5,000.00 around Metal Support Frame.
withSizes(Bottom):600mmDiameteretccompletetothesatisfaction of the Architect & Engineer in charge. iv Supply, Installation, Testing&CommissioningofDecorativeIighting Fixtures-PLICA,aPendantLuminaireconsistingonelayerofFeltwith anOffWhiteorBlacklace.Thelightweightsculpturalshadeiscreated bypleatingorsmockingsoundabsorbingFELT.Thearchitecturalfolds 2 NOS 2 5,000.00 5 0,000.00 has maximized surface area, delivering practical sound absorbing properties. The dimensions shall be Height - 100mm, Diameter - 600mmetccompletetothesatisfactionoftheArchitect&Engineerin charge.
v Supply, Installation, Testing&CommissioningofDecorativeIighting Fixtures-PLICA,aPendantLuminaireconsistingonelayerofFeltwith an Multi colored (Except Off White or Black) including lace. The lightweightsculpturalshadeiscreatedbypleatingorsmockingsound absorbingFELT.Thearchitecturalfoldshasmaximizedsurfacearea, 2 NOS 2 5,000.00 5 0,000.00 deliveringpracticalsoundabsorbingproperties.Thedimensionsshall beHeight-100mm,Diameter-900mmetccompletetothesatisfaction of the Architect & Engineer in charge.
vi Supply&Installationofsinglecolor(warmwhite2800klight/any otherapprovedcolor)flexibleLEDstriplightincludingrequiredrated driver/powersupplyinmultiplesof1Rmtrasapprovedbycategory& 250 R.Mts 4 50.00 1 ,12,500.00 modelsinotherasapprovedmakebyclient/architect/Engineer.) including cost and conveyance of all materials, taxes and all labor charges etc complete.
vii Supply,installation,testing&commissioningAluminiumSurfaceProfile Light, Thickness (mm): 10 mm, Size (inch X inch): 78 Inch of all 485 R.Mts 7 50.00 3 ,63,750.00 materials, taxes and all labor charges etc complete.
viii SupplyandInstallationof20WBattenLEDlightfixtures(Decorative Lights)SURFACEtypewithallinterconnectionsandfixingarrangement asrequired.(LUMILINEBS18WLED857SPCWH-HavelsorBN021-21S 30 NOS 3 ,000.00 9 0,000.00
in Philips orCROMPTON: LDL-20-CDLor equivalent)(Basic Rateof Fitting shall be Rs. 2,000 / No) ix SupplyandInstallationof22"x 22"14mmK9crystalChandelier/ DecorativeStainGlassChadeliersaspermanufacturersspecifications, 3 NOS 5 5,000.00 1 ,65,000.00 standardsandasperapprovaloftheArchitect.(BasicRateofFitting shall be Rs. 40,000 / No) n Supply&Installation ofCrystalGlass film 8150 OPTICALLYCLEAR withapprovedartwork,cutusingdigitalplotterandprint(latex).Self- adhesive, bubble-free installation to be done on clean glass , by Authorized Installers only.3M Architectural Markets. 3M interior 20 Sqm 4 ,200.00 8 4,000.00 warrantyforaperiodof3yearsforInteriorapplicationtobesubmitted along with invoice by 3M directly to the customer.Rs. 2260 per sqmtr.
o Providing and fixing of Matt natural anodized aluminium skirting profileof75mmheightinclusiveof12mmthickplybackingwherever required, and with all accessories and installation as per the 40 R.Mts 7 50.00 3 0,000.00 manufacturers specifications. Rate should include preparation of surface. The skirting shall be fixed as per details & Architects instructions.
20 Providing and fixing high end, premium quality, reflective designer frostedfilmofLlumar/3Morequivalentapprovedmakeandshadeto befixedtoglassesofalltypes,windows,partitionglasses,panelled 40 Sq. Mtr. 2 ,155.00 8 6,200.00 glass surfaces etc complete as instructed by Architect.
19921 MR RECEPTION COUNTER 2 Nos 8 5,000.00 1 ,70,000.00 Providing and supplying Reception counter of size 15'-0" in length comprising of various shapes - circular & straight length and 2'-0" widthand2'-6"heightincludingbelevvededgedglass,12mmthkon top supported on stainless steel hollow pipes, 75mm dia & height belowtopbeminimumof1'-0".Thetablebelowthepipetobemade outof19mmthkCommercialplywithfrontaprontobein19mmthk Commercial ply (flexible for curvature portion) to be finished with approved18mmthkonyxitalianmarbleincludingprovisionofwarm/ colouredlightingbehindtheonyxforglowingeffect.Thetopofthe countershallbeprovidedwithCorianQuartzofDupontorequivalent approved including approved Corian for sides & all other exposed surfaces.
The rate shall include 1 no of pedestal drawer units on castors comprisingof3nosofequalsizeddrawersonsidetobefinishedwith
4.0mmthkapprovedveneerwithmelaminepolish.Therateshallalso include the elevational treatment to be provided with recessed designercorianofapprovedshadewithbacklitwithinveneerborders & tray at skirting level including planters, pebbles & creeper arrangementdesignandincludingheavydutyCPUtrolleys&keyboard trays of standard make on sliding channels as per manufacturers specifications etc complete.
Allexposedverticalfascias/surfacesofthecountershallbefinished withapproved6mmthkCorianmaterialexceptthetop,whichshallbe finishedwith12mmthkCorianandthefrontapronofthetablewhich shallhaveonyxstoneandinlaydesignasmentioned.Thedrawerunit shall be finished with 4.0mm thk veneer with melamine polish & internalsurfacesshallbefinishedwith0.8mmthklaminateincluding making the necessary openings for wires of telephone boards, PC, grooves, mouldings, etc complete.
22 MR ProvidinganderrectinginpositionConferenceRoom/Discussion Roomtables tobe madeout of19mmthkPlywood topwith 60X 60mmthkt.w.mouldingallroundthetoptobefinishedwithapproved
3.0mmthkhighendveneerincludingapprovedpolycoatpolish/6mm thkCorian/10mmthkLacqueredGlassasperdirections,instructions andtobeerrectedonacentralcoresupportcomprisingofframingof t.w75X75mmthkmouldedframevertical,horizontalattop&bottom &includingbracingsataregularintervalofminimum900mmcentres, whichshallhave19mmthkplyononesideincaseofsolidrectangular table base or both sides incase of tables with central cut outs or openingsandtobefinishedwithapproved3.0mmthkveneerwith melaminepolish.Alltheexposedmiddleverticals&framing(aprons) shallbefinishedwith19mmthkplywoodandapproved3.0mmthk natural veneer with melamine polish as per the drawings & instructionsoftheArchitect.Allexposedsurfacesexceptthetopofthe table to be f per manufacturers specifications and standards.
(Quantification of the Panels shall be done in t The rate shall be inclusive of necessary cut outs & provisions for video/tele conferencing including providing and fixing in position, cable&wiremanagersaspop-upmanagers/cablechubby,indesired number as per instructions and directions, necessary hardware, cablingarrangementsforvideo/teleconferencing(Actualcablewould be quantified separately), openings /cut outs for speakers etc complete.Therateshallalsoincludeprovidingfootrestfixedtothe centralcoresupportsectionofthetableofprojectionwidthasdirected to be finished with approved veneer with melamine polish etc complete.
Therateshallbeinclusiveofmakingprovisionsforallservicessuchas AV controls, Electrical installations, gadgets etc. The rate shallalso include the provisions for making the table moveable including providing&fixingheavydutycastors,lockingarrangementsforthe castorsetccomplete.Therateshallalsoincludeprovisionsforallthe necessary hardware, fittings, fixtures etc as directed and to the completesatisfactionoftheArchitects&Clients.Rateshallalsoinclude makingacutoutinthecentreoftableofsize26'-0"X1'-0"tobefilled with ArtificialPlanters and White Pebbles and tobe providedwith Glass,8mmthkwithbevellededgesandwiththeedgesoftheglass matching the veneered / corian top as directed etc complete a Board Room Oval Table - Size of Table - O/O - 32'-0" X 5'-0" with
1.00 No 4 ,50,000.00 4 ,50,000.00 specifications as above. a Rectangular Size of Table - 6'-0" X 3'-0" with specifications as above. - No 5 5,000.00 QRO b Rectangular Size of Table - 12'-0" X 3'-6" with specifications as above. - No 9 0,000.00 QRO c Rectangular Size of Table -14'-0" X 4'-0" with specifications as above. 1.00 No 1 ,50,000.00 1 ,50,000.00
10.00 SERVER ROOM i Server table (3'0"x2'0") 1.00 Nos. 9 ,000.00 9 ,000.00 MR Providing and erecting Server / communication tableorcounterto madeoutof19mmthk.Commercialply.Thetabletohaveheavyduty keyboardtraysandwithapedestaldrawerunitcomprisingof3nosof equalsizeddrawersincludingnecessaryopeningforelectricalwiring, sockets,AVcontrolsetccomplete.Thetopofthetableshallbefinished withapproved1.0mmthklaminateand1.0mmthklaminateinternally etc complete as perinstructions ofthe Architect. Therate shallbe inclusiveofheavydutyCPUtrolleys,footrest,wiremanager,provision forelectrical,AV&otherassessories,cutoutsforswitch-socketsetc complete.
200i MR Full Height Storage - Laminate Finish (450mm Deep) 25.00 Sq. Mtr. 7 ,900.00 1 ,97,500.00 ProvidingandfixingFullheightStorageofheightapproximately7'-0" and 450mmdepth at locations as specified in the drawings as per specification below.
Skeleton-madeoutof19mm.thkcommercialplyatendverticals,top andbottomandverticals450mmto600mmCentresand6mmthk back commercial ply.
SHELVES-19mmThk.CommercialPlywoodtopandedgesfinishedin
1.0mm thk. Laminate to accommodate file height removable and supported on pins.
SHUTTERS-made out of 19mm thk. Commercial ply externally and internally finished with 1.0 mm thk laminate as shown or directed.
HINGES -Each shutter shall have 100mm long oxidised brass butt hinges.Mimimum4nos.hingesforeachoftheshutterforFullheight Storage and 3 Nos. hinges for each of the shutter for Low Height Storage to be provided.
BOLTS - Flush tower bolts from inside at top and bottom to the shutters and magnetic catch fixed top and bottom.
LOCKS - of approved make 4 -lever brass body dead lock with S.S. Key.
HANDLES-Concealedhandlesminimumof100mmwideasapproved by the Architect.
SKIRTING-AsinstructedbyArchitect,incommercialplywoodfinished in Laminate. ii MR Full Height Storage - Laminate Finish (600mm Deep) 15.00 Sq. Mtr. 8 ,650.00 1 ,29,750.00 ProvidingandfixingFullheightStorageofheightapproximately7'-0" and 600mmdepth at locations as specified in the drawings as per specification below.
Skeleton-madeoutof19mm.thkcommercialplyatendverticals,top andbottomandverticals450mmto600mmCentresand6mmthk back commercial ply.
SHELVES-19mmThk.CommercialPlywoodtopandedgesfinishedin
1.0mm thk. Laminate to accommodate file height removable and supported on pins.
SHUTTERS-made out of 19mm thk. Commercial ply externally and internally finished with 1.0 mm thk laminate as shown or directed.
HINGES -Each shutter shall have 100mm long oxidised brass butt hinges.Mimimum4nos.hingesforeachoftheshutterforFullheight Storage and 3 Nos. hinges for each of the shutter for Low Height Storage to be provided.
BOLTS - Flush tower bolts from inside at top and bottom to the shutters and magnetic catch fixed top and bottom.
LOCKS - of approved make 4 -lever brass body dead lock with S.S. Key.
HANDLES-Concealedhandlesminimumof100mmwideasapproved by the Architect.
SKIRTING-AsinstructedbyArchitect,incommercialplywoodfinished in Laminate. iii MR Low Height Storage - Veneer Finish 5.00 Sq. Mtr. 7 ,850.00 3 9,250.00 Providingandfixing LowheightStorageofht.2'-6"or4'-0"asdesired and depth of 450mm as per specification below.
Skeleton - made out of 19 mm thk Commercial Plywood at end verticals,topandbottomandverticals450mmto600mmCentresas directed and 6 mm thk commercial back ply.
SHELVES-Atappropriatelocationsin19mmThk.CommercialPlywood topandedgesfinishedin1.0mmthk.Laminatetoaccommodatefile height removable and supported on pins (To carry a load of 10-15 kgs).
SHUTTERS-Madeoutof19mmthk.CommercialPlywoodexternally finishedwith1.0mmthklaminateinternallyandexternallywith3.0 mm thk. Veneer with approved shade of Melamine polish as directed.
HINGES -Each shutter shall have 100mm long oxidised brass butt hinges.Mimimum4nos.hingesforeachoftheshutterforFullheight Storage and 3 Nos. hinges for each of the shutter for Low Height Storage to be provided.
BOLTS - Flush tower bolts from inside at top and bottom to the shutters and magnetic catch fixed top and bottom.
LOCKS - of approved make 4 -lever brass body dead lock with S.S. Key.
HANDLES-Concealedhandlesminimumof100mmwideasapproved by the Architect.
SKIRTING-AsinstructedbyArchitect,incommercialplywoodfinished in 3.0 mm thk veneer with melamine polish iv MR Pigeon coup in laminate finish . 7.00 Sq. Mtr. 8 ,100.00 5 6,700.00 Providing&fixinginpositionpigeoncoupofsizeasperdirectionstobe made out of 19 mm commercial ply and covered with 1 mm thk.
Laminateofapprovedshadeforaprons,top,shutteretccompletedas per details & architect's instruction.
201v. MR Overhead storage - Laminate finish 6.00 Sq. Mtr. 9 ,500.00 5 7,000.00 Providingandfixing OverheadStorageofht.2'-0"orasdesiredand depth of 375mm as per specification below.
Skeleton - made out of 19 mm thk Commercial Plywood at end verticals,topandbottomandverticals450mmto600mmCentresas directed SHELVES-Atappropriatelocationsin19mmThk.CommercialPlywood topandedgesfinishedin1.0mmthk.Laminatetoaccommodatefile height removable and supported on pins (To carry a load of 10-15 kgs).
SHUTTERS-Madeoutof19mmthk.CommercialPlywoodexternally finishedwith1.0mmthklaminateandInternallyfinishedin1.0mm thk. Laminate as directed.
HINGES-Eachshuttershallhave2-3Nos.hingestobeprovidedasper directions.
BOLTS - Flush tower bolts from inside at top and bottom to the shutters and magnetic catch fixed top and bottom.
LOCKS - of approved make 4 -lever brass body dead lock with S.S. Key.
HANDLES-Concealedhandlesminimumof100mmwideasapproved by the Architect. iii MR Lunch counter 6.00 R.Mtrs 5 ,900.00 3 5,400.00 Providing2'-0"widelunchcounterinplytobefinishedwith18mmthk jetblackgraniteforthetopand1.0mmthkapprovedlaminateforthe remainingexposedareasincludingthenecessarysupportsinplytobe finishedwith1.0mmthklaminateincludingneccesaryhardware,half roundmoulding/nosingtoand forthe jetblack granitetop tobe providedfortheentirefrontareasofthecounter&supports,hardware etc complete iv MR Shutter below Granite counter - Laminate finish 14.00 Sq. Mtr. 7 ,000.00 9 8,000.00 Providing&fixingshuttersmadeoutof19mmthickmarineply(IS303) with19mmx12.50mmbeadingallaroundwith1mmthicklaminate finishedforstoragebelowGranitecounterincludingmelaminepolish etcincludingallnecessaryhardwaresuchashiges,concealedhandle.
Therateshallbeinclusiveofproviding&fixingmodularS.Sservice trolleys below with standard sliding channel sections as per manufacturersspecificationsforthecompletelengthandheightofthe counterincludingshuttersinmarineplywoodincludingthenecessary t.w frame etc complete.
v MR Acrylic panel on ss studs (2'0"x2'6") 8.00 Nos. 2 ,700.00 2 1,600.00 Providing&fixing2layersofsandwich6mmthkhardstrengthacrylic sheet to be fixed over S.S studs etc complete vii MR Pantry SS Sink bowl 0.00 Nos. 1 5,000.00 QRO Providing&fixingofNirali/Omni/equivalentmake,Big18"x18"bowl sizeSSsinkbowlwithallnecessaryacc.i.e.wastecoupling,flexible drain pipe, Pillar cock, Stop Cock etc. Complete.
23a MR Providing&FixinginpositionPaintings,Artefacts,Muralsandother 1 Lot 3 ,50,000.00 3 ,50,000.00 decorative elements including b MR SupplyingandplacinginpositionGreenwallwithnaturalplantersas backdrop as per directions and instructions including necessary provisions for watering, temperature and humidity control and 1 Lot 1 ,25,000.00 1 ,25,000.00 measurementdevicesetccompleteincludingpots,biophiliclesswater consuming natural plants etc complete 24 MR Compactors 0 Sq. Mtr. 9 ,150.00 QRO ProvidingandErrectinginpositionCompactorsinfixeddoublefaced storage spaces with feather touch mobility in metallic fabrication, storage cabinets mounted on white metal monorail with 6 levers centralizedlockingmechanisminsinglekeylockingarrangement.The fabrication should have rustpreventive treatmentwith ovenbaked enamelpaintfinishincludingheavydutygriphandwheelwithstandard shelveslateral&verticalincludingmannualandlatchlockinghandles with end stoppers, safety device preventing accidental closure including all fittings, locking, fixtures, hardware etc complete. The contractor to submit the brochure of the manufacturing company before quoting. The itemwould be measured as Running Length X Height of the entire assembly of all the cumulative units.
26 MR ProvidingandsupplyingPlanterBoxestobemadeoutof19mmthk. plytobefinishedwith1.0mmthkLaminateexternally&painted(Black Color)frominsideasperthedrawingandinstructionsoftheArchitect etc.complete.RateshallalsoincludeProvidingNaturalPlanterswhich shallbegotapprovedthroughtheArchitects&theBankandsupplied and placed in the boxes as per their approval.
a 1.32M(L) x 0.45M(W) x 0.30M(H) 20 Nos. 5 ,000.00 1 ,00,000.00 b 0.70M(L) x 0.45M(W) x 0.30M(H) 20 Nos. 4 ,000.00 8 0,000.00 27 MR Slotted angle storage racks 20 Sq. Mtr. 2 ,700.00 5 4,000.00 Providing & installation of metal slotted angle racks finished with powdercoatedpaintwithallnecessaryhardware,etccomplete.Height 7'0",Depth15"tobeconsidered.Loadingcapacityshouldbe80kgUDL / level
SUM TOTAL OF SECTION B : - INTERIOR WORKS Rs. 2 ,60,12,260.00 202SUMMARY OF CIVIL & INTERIOR WORKS
SUM TOTAL OF SECTION A : - CIVIL WORKS Rs. 1 ,09,08,918.02
SUM TOTAL OF SECTION B : - INTERIOR WORKS Rs. 2 ,60,12,260.00 GRAND TOTAL COST OF SCHEDULE I - CIVIL & INTERIORWORKS {GRAND TOTAL OF SECTIONS 'A' Rs. 3 ,69,21,178.02 & 'B'} For SHETGIRI AND ASSOCIATES 203PROPOSED INTERIOR RENOVATION & FURNISHING WORKS FOR OFFICE OF PFRDA, 16TH FLOOR, MAKER TOWERS - F, CUFFE PARADE, MUMBAI S.No Description Qty. Unit Rate Amount SCHEDULE II - LOOSE FURNITURE WORKS 1 Cabin Tables ProvidingandsupplyingtablefortheTopManagement&SeniorExecutivesof theOrganizationasshownintheplanorasapproved,tobemadeoutof19mm thk. Plywood finished with approved 4.0mm thk high end & premium class veneerwithpolycoatpolishforthetop.Thefront&sideapronstohave4.0mm thkhighendandpremierclassveneerwithhighendmelaminepolish.Thetop of the table to have t.w. moulding all around the table to be finished with polycoatpolishofapprovedshade.Therateshallbe inclusiveofprovidinga heavydutykeyboardtrayonslidingtelescopicchannels&apedestaldrawer unit made out of 16mm thk marine ply on side with 2 nos of equal sized drawersonslidingchannels&openableshutterbelowtobefinishedwith4.0 mm thk high end veneer with high end melamine polish for the external exposed surfaces (Pedestals shall beprovided for allthe tableson theother sideoftheSideCredenzaexceptfortheHon'bleChairperson'sTablewherein Credenza on both sides shall be provided per TherateshallalsoincludingprovidingandfixinginpositionSidecredenzaon onesideofthetable(ExceptforHon'bleChairperson'sTablewhereinCredenza onbothsidesshallbeprovided)ofSize3'-6"(Length)X1'-6"(Width)X2'-6"
(Height)foralltablesandtobefinishedwith4.0mmthkhighendveneerwith highendmelaminepolishfortheexternalexposedsurfacesandinternallywith
0.8mmthklaminate. ThetopoftheSidecredenzashallhave4.0mmthkhigh endveneerwithpolycoatpolishforthetopandhighendmelaminepolishfor all the other exposed sides All internal surfaces to be finished in approved 0.8mm thk laminate. Allthe externalexposedsurfacesshallbefinishedwith4.0mmthkapprovedhighend veneerwithmelaminepolishincludingthedrawerunitexceptthetopwhich shallhavepolycoatpolish.TherateshallalsoincludeheavydutyCPUtrolleyof reputedmanufacturer.Thenecessaryhardwaresuchasautomaticlocking,ball catches, wire managers etc to be provided as per the instructions of the Architect.TheElevationofthetableshallbeasdirectedbyArchitectonsite, whichshallincludedesigninlaysin SS,and centralpanel tobefinishedwith combination of muralic arrangement, seperator jali and square bevelled designer glass panels on SS studs etc complete.
Therateshallbeinclusiveofnecessaryopenings &provisions forvideo/tele conferencing, wire managers, necessary hardware, cable cubby, cabling arrangementsforvideo/teleconferencing,openingsforspeakers,provisions &cutoutsforinstallationofgadgetsetccomplete.Therateshallalsoinclude providingstand-alonefootresttothetableofprojectionwidthasdirectedto befinishedwithapprovedveneerwithmelaminepolishetccomplete forthe entire length of the table.
Thefinishontopshallbepostformedfinish.Toparewith25mmthkboards with post formation on 2 sides and 2mm PVC edge banding with enhanced scratchresistancesupportedon25mmthk.Gableendsand18mmthkModesty panels.Exposededgesarein2mmthkPVCedgebanding&sealededgesarein
0.8mmthkPVCedgebanding.Separateprovisionformountingswitchesonthe walls/partitionsadjoiningthetablesshallbemadebycustomerasthetables donotcomewithswitchmounting facility.Wire routing/wiremanagement groumets (Patented Squeezee) shall be provided on main or side table as specifiedbycustomer.KeyboardTrayMetal19"withmousepad+MetalCPU Trolley shall be inclusive in the rate quoted a TablefortheHon'bleChairpersonofSize-Effectivelengthof8'-0"(Including curvatureatthefreestandingendofthetable)X3'-0"(AvgCentre-Clear)with 1 Nos 8 5,000.00 8 5,000.00 specifications as above.
b Table for the Hon'ble Senior Funtionary of Size - Effective length of 6'-6"
(Includingcurvatureatthefreestandingendofthetable)X2'-9"(AvgCentre- 1 Nos 6 5,000.00 6 5,000.00 Clear) with specifications as above. c (i) Tablefor the Hon'bleChief General Manager's ofSize - Rectangular Table of Effective length of 6'-0" X 2'-9" (Avg Centre - Clear) with specifications as 2 Nos 5 7,500.00 1,15,000.00 above.
(ii) TablefortheHon'bleGeneralManager's&Hon'bleSr.ExecutiveTableforNPS of Size - Rectangular Table of Effective length of 6'-0" X 2'-9" (Avg Centre - 3 Nos 5 7,500.00 1,72,500.00 Clear) with specifications as above.
d TablefortheHon'bleDeputyGeneralManager's&Hon'bleExecutiveTablesfor NPSofSize-RectangularTableofEffectivelengthof6'-0"X2'-9"(AvgCentre- 6 Nos 5 0,000.00 3,00,000.00 Clear) with specifications as above.
2042 Cubicle Tables (Secretariat Tables) Supply&installationofWorkstationswithintheCubiclesasperlayoutofsize- RectangularTableofEffectivelengthof5'-6"X2'-6"+PedestalDrawerUniton onesideofthetable+MetalKeyboardTray19"withMousePadandMetalCPU trolleyincludingSideCredenzaUnitofSize3'-0"(Length)X1'-6"(Width)X2'- 6" (Height) attached with & including the enclosure partition. The Partition shall be included and comprising of minimum 4'-0" to 4'-6" height and minimum2.5"to3"thicktwotileslidingbasesystem.Ratetoincludeproviding combinationsinthePartitionenclosureswithAccouticboard,Softboardtiles 2 Nos 4 5,000.00 9 0,000.00 of approved color, shade & texture, Magnetic boards, white boards marker tiles, Pre-VeneeredMDFboards&combinationwithGlassPanelsin6mmthkGlass withdesignerfrostedfilmofapprovedmake,shade&texture.Tabletopsshall be made of 25mm thk Pre-Veneered MDF boards of approved finish
conformingtoIS:12823InteriorGradewith2mmthickpvcedgebandingof matching shade to make it m per manufacturers specifications and stan AspeciallydesignedpowdercoatedM.S.bracketsshallbefixedtothepartition frametosupportthetabletops.Gableendsshallbemadeof25mmthkprelam MDFboardofapprovedfinishwithbothsideVeneer(BSV)andconnectedto frame with help of metal powder coated brackets to support table top.Side Credenza Unit of Size 3'-0" (Length) X 1'-6" (Width) X 2'-6" (Height) :
Completely made up of MDF board conforming to IS : 12823 Interior Grade withPVCedgebanding.Topisin25mmthkboardwith2mmpostformationon 2sidesand2mmPVCedgebandingsupportedon25mmthk.Gableendsand 18mmthk.Modestypanel.Exposededgesarein2mmthkPVCedgebanding& sealed edges are in 0.8mm thk PVC edge banding. Separate provision for mountingswitchesonthewalladjoiningthetablesshallbemadebycustomer as the tables do not come with switch mounting facility.
Whiteboard Marker tiles: Made out of 6mm MDF with 0.8mm glossy highly wearresistantfacelaminatewithabalancinglaminateof0.8mmthickonthe back. The rate shall include Providing & Fixing in position Pedestal Drawer Unit, made out of 18mm thick pre-veneered MDF Board conforming to IS :12823InteriorGrade.Alltheexposededgesaresealedwith2mmthickPVC edgebandingonsidesandbottom.Thetopanddrawerfasciatobesealedwith 2mmthickPVCedgebandingofmatchingshade.Thedrawerunitconsistsof2 box drawer and 1 filedrawer.The sides ofInside drawer box are ofprelam MDFboardofdesiredshade.ThedrawerboxisfittedwithrollerSlideforfree movement.Thedrawerunitisprovidedwithcentrallockingsystem,wherein thethreedrawerarelockedwithonekey.PVCrecessedhandlesareprovided for easy opening and closing of drawer.
Thedrawerunitisfittedoncastorsforeasymobility.PVCedgebandingshallbe of Rehau or Dolken of german make The complete furniture unit is factory assembled with knock down fittings. The pedestal is fitted with additional
(5th)castortoavoidtopplingincaseofopeningallthethreedrawers.Allthe hardware & channels are from Hettich/Ebco.
Thefinishontopshallbepostformedfinish.Toparewith25mmthkboards with post formation on 2 sides and 2mm PVC edge banding with enhanced scratchresistancesupportedon25mmthk.Gableendsand18mmthkModesty panels.Exposededgesarein2mmthkPVCedgebanding&sealededgesarein
0.8mmthkPVCedgebanding.Separateprovisionformountingswitchesonthe walls/partitionsadjoiningthetablesshallbemadebycustomerasthetables donotcomewithswitchmounting facility.Wire routing/wiremanagement groumets (Patented Squeezee) shall be provided on main or side table as specifiedbycustomer.KeyboardTrayMetal19"withmousepad+MetalCPU Trolley shall be inclusive in the rate quoted 3 Work Stations for Officers (5'-0" x 5'-0") A Providing, Supplying & installation of Angular workstations as per layout of size 5'-0" X 5'-0" X 2'-0" & Height of 2'-6" including 18 mm Thick Front LacqueredGlass/MagnaticboardscreentypewithaluminumframewithPVC bracket 300 mm (1'-0") height. The Table tops shall be made of 19mm thk 24 Nos 3 5,000.00 8,40,000.00 CommercialPlywoodwithapproved1.0mmthklaminatebothsidesoftopin
seude finish conforming to IS : 12823 Interior Grade with 2 mm thick pvc edgebanding of matching shade to make it make it more resisitant towards hAesapt eacniadl lmyodiesstuigrnee. dpowdercoatedM.S.bracketsshallbefixedtothepartition frame to support the table tops. Gable ends shall be made of 19mm thk Commercialplywoodwithsuedefinishwithbothside1.0mmthklaminateand connectedtoframewithhelpofmetalpowdercoatedbracketstosupporttable top.
205The free space available within raceway accommodates power, data and communicationcables.MetalCPUTrolley&Keyboardtraytobeprovided.Rate shallinclude Providing &Fixing ofLow height Partition Screen (Screen type enclosure to be provided) to comprise of Bottom Tile with Bottom row of frametocontinueuptotheFinishedfloorlevelifsodesiredandtobeprovided with12mmthk303MRgradeCommercialPlywoodscrewedtoframeworkon bothsideswithjointsasshownordirectedandFabric/Accousticpaneland below the workstation, if desired in 1.0mm thk laminate on both sides in standardcolor.ThescreenshallcompriseofLacqueredGlass/Fabricboard/ Accosticboardabovetheworkstationtopaspermanufacturersspecifications andstandards.TheWhiteboardMarkertilestobemadeoutof6mmMDFwith 08mmglossyhighlywearresistantfacelaminatewithabalancinglaminateof
0.8mm thick on the back.
ThePedestalUnitismadeof16mmthkmarineplywith3nosofequalsized drawersontelescopicchannelsandtobefinishedwith1.0mmthkapproved laminateonalltheexposedsurfacesi.e.front,sides,rear,baseandtop.Allthe exposed edges are sealed with 2mm thick PVC edge banding on sides and bottom.Thetopanddrawerfaciaaresealedwith2mmthickPVCedgebanding ofmatchingshade.ThesidesofInsidedrawerboxareofplywood.Thedrawer boxisfittedwithrollerSlideforfreemovement.Thedrawerunitisprovided with central lockingsystem,where in the three drawer are locked with one key. PVC recessed handles are provided for easy opening and closing of drawer.
Thedrawerunitisfittedoncastorsforeasymobility.PVCedgebandingshallbe of Rehau or Dolken of German make The complete furniture unit shall be customizedonsitewithsite-in-situorcouldbeallowedtobemanufacturedEx- factory and assembled with knock down fittings. The pedestal is fitted with additional (5th) castor to avoid toppling in case of opening all the three drawers. All the hardware & channels are from Hettich/Ebco.
TABLE TOP : 19mm thk Commercial Plywood with 1.0mm thk laminate as indicated above with 2mm thick PVC edge banding finish as per approved laminate color.
END SUPPORT LEGS : Aluminum Type Legs powder coated finish as per approvedshade.OrProviding&FixingofLowheightPartitiontocompriseof BottomTilewithBottomrowofframetocontinueuptotheFinishedfloorlevel and to be provided with 12mm thk 303 MR grade Commercial Plywood screwed to frame work on both sides with joints as shown or directed and
1.0mm thk laminate on both internal and external sides in std color as directed
MIDSUPPORTLEGS:MetalType-60X30rectangularLegpowdercoatedfinish as per approved shade or Providing & Fixing of Low height Partition to comprise of BottomTile with Bottom row of frame to continue upto the Finished floor level and to be provided with 12mm thk 303 MR grade Commercial Plywood screwed to frame work on both sides with joints as shownordirectedand1.0mmthklaminateonbothinternalandexternalsides in std color as directed
BEAM : 40mm x 40mm CRC square pipe with powder coated finish as per approvedshadeprovideddiecastedbracketstosupporttopwithskinningand
1.0mm thk laminate finish
FLAPPER : Access Flap Powder coated flushed with top - 450 x 120 mm.
WIRE CARRIER : Powder coated wire carrier to be provided for arranging wires for electricity & data.
WIRERISER:Powdercoatedwirerisertobeprovidedforraisingwiresform floor.
Thescreen300mmHeightshallcompriseofFabrictiletobeconstructedoutof 4mmthickMDFboard,andcoveredwithfabricofstdcolor.Softpinuptile: madeoutof0.8mmthickgalvanizedironsheetwith8mmthickcrosslinked foamandcoveredwithfabricofstdcolor.WhiteboardMarkertiles:Madeout of 6mm MDF with 0 8mm glossy highly wear resistant facelaminate with a balancing laminate of 0.8mm thick on the back.
FRONT&LEGSIDEMODESTY:MetalType perforatedfront modestypowder coated finish as per approved shade 450 HT or Providing & Fixing of Low height Partition to comprise of BottomTile with Bottom row of frame to continueuptotheFinishedfloorlevelandtobeprovidedwith12mmthk303 MR grade Commercial Plywood screwed to frame work on both sides with joints as shown or directed and 1.0mm thk laminate on both internal and external sides in std color as directed MOVABLE DRAWER 400X450X 600 MM (2D+1F) : As per specifications indicated herein above 206B Same-DoasaboveSpecification-,howeverProvidingProviding,Supplying& installationof120degreesFree-standingworkstationsasperlayoutofsize5'- 0"X5'-0"X2'-0"inclusterof3each&Heightof2'-6"including18mmThick Front Lacquered Glass / Magnatic board screen type with aluminum frame with PVC bracket 300 mm (1'-0") height. The Table tops shall be made of 19mmthkCommercialPlywoodwithapproved1.0mmthklaminatebothsides 18 Nos 5 2,000.00 9,36,000.00
oftopinseudefinishconformingtoIS:12823InteriorGradewith2mmthick pvcedgebandingofmatchingshadetomakeitmakeitmoreresisitanttowards heat and moisture. All the above specifications would remain the same.
C Linear Workbenches for Staff Supply & installation of Linear Workbenches as per layout size 1200Lx600Wx600H mm to be mounted over Low Height PARTITION: With minimumdimensionof1200mm±10mmheightandminimum60mm±10 mmthicktwotileslidingbasesystem(Partitionshallbequantifiedhereinthe said item of Workstation & no seperate payment towards Partitions or its
6.00 Nos 3 2,000.00 1,92,000.00 finishesshallbemadeelsewhere).Tabletopsshallbemadeof25mmthkPre-
laminatedParticalboardsofapprovedlaminateseudefinishconformingtoIS:
12823InteriorGradewith2mmthickpvcedgebandingofmatchingshadeto make it make it more resisitant towards heat and moisture.
AspeciallydesignedpowdercoatedM.S.bracketsshallbefixedtothepartition frametosupportthetabletops.Gableendsshallbemadeof25mmthkprelam Particalboardofsuedefinishwithbothsidelaminate(BSL)andconnectedto frame with help of metal powder coated brackets to support table top.
Frames:-Partitionthicknessshallbeof60mm±10mmforstabilityandwith the inside gapbetween twotile isapproximately 50mm± 10mmforhigher wire carrying capacity.FrameHorizontalsshallbemade of1mmthickCRCA sheets&theverticalsaremadeofAluminiumExtrusionsof1.5mmthick,All theframeswillbedulypowdercoatedupto50-60dft,whichwillbeinlinewith theToptrims&endtrims,AlltheCapsvizend,inline&universal&raceway caps are made out of Die-cast Aluminum. The partition must have three integratedracewayprovidedoneatskirtinglevelandanothertwoatbelow& above the work surface level thus ensuring separation of power and networking cables. PARTITION SHALL BE INCLUDED and comprising of combinations in the Partition enclosures with Soft board tiles of approved color, shade & texture, Magnetic boards, white boards marker tiles, Pre- laminated MDF boards & combination with Glass Panels in 6mm thk Glass (Glass proposed only for end workstations) with designer frosted film of approved make, shade & texture.
The free space available within raceway accommodates power, data and communication cables.MetalCPU Trolley &Keyboard tray to beconsidered.
BottomTile: Bottom row of frame is of MDF prelam, from both internal and external sides, made of 6 mm thick MDF board with std color. Fabric tile:
Constructedoutof4mmthickMDFboard,andcoveredwithfabricofstdcolor.
Softpinuptile:madeoutof0.8mmthickgalvanizedironsheetwith8mmthick cross linked foam and covered with fabric of std color.
AdrawerUnitwith2numberofpencildrawersforeachoftheworkstations made of 18mm thick pre laminated Partical Board conforming to IS :12823 InteriorGradetobeprovidedfromthetopofthetable.Alltheexposededges aresealedwith2mmthickPVCedgebandingonsidesandbottom.Thesidesof InsidedrawerboxareofprelamParticalboard.Thedrawerboxisfittedwith roller Slide for free movement. The drawer unit is provided with individual locking system. PVC recessed handles are provided for easy opening and closing of drawer.
4(A) Supply&installationofStorageUnitsuptoanydesiredlength750mmheight& 450mmdeepmadeoutof19mmthkCommercialPlywoodtobefinishedwith
1.0mm thk laminate duly approved, of desired finish, shade & texture conforming to relevant IS code, Interior Grade with 2 mm thick pvc edgebanding of matching shade to make it make it more resisitant towards heatandmoistureincludingshuttersfinishedin1.0thklaminateexternally&
0.8mmthklaminateinternallytobemountedonhingesfixedto50mmx25mm 60 Sq. Mtr. 1 1,000.00 6,60,000.00 tw frame polished internally and laminate on all exposed external surfaces inclusiveofintermediateshelffinishedinlaminate@375mmc/c,asperspecs and 100mm skirting to be finished with laminate. Rate to include Godrej or equivalent locks, SS designer handles, hinges including all necessary fittings, fixtures, hardware, assessories etc complete.
207RatetoalsoincludecreationofPlanterboxesabovetheStorageunitsin19mm thkCommercialplywoodwithAluminiumfoillininginsidetheplanterboxand fillingthesamewithwhitepebbles,biophilicplanterswithitsboxtobefilled withrequisitesoil,temperaturethermometerandhumiditycontrolmeteretc complete.
(B) LOW HEIGHT STORAGE FOR CABINS Providing and fixing Low height Storage ofht. 2'-6" or 4'-0" as desired and depth of 16" or 18" as specified in the drawings as per specification below. 83 Sq. Mtr. 1 1,700.00 9,71,100.00 Skeleton-madeoutof19mm.Thkplyatendverticals,topand bottomand verticals450mmto600mmCentresasshownindrawingand6mmthkback ply.
SHELVES-19mmThk.Plywoodtopandedgesfinishedin0.8mmthk.Laminate to accommodate file height removable and supported on pins.
SHUTTERS-made out of 19mm thk. ply externally finished in 3.0mm thk apptovedhighendpremierclassVeneerwithmelaminepolishandInternally finished in 0.8 mm thk. Laminate as shown or directed.
HINGES - Each shutter shall have 100mm long oxidised brass butt hinges.
Mimimum4nos.hingesforeachoftheshutter forFullheightStorage and3 Nos. hinges for each of the shutter for Low Height Storage to be provided.
BOLTS-Flushtowerboltsfrominsideattopandbottomtotheshuttersand magnetic catch fixed top and bottom.
LOCKS - of approved make 4 -lever brass body dead lock with S.S. Key.
HANDLES - 100mm wide handles of brass as approved by the Architect.
SKIRTING-AsinstructedbyArchitect,inplywoodfinishedinapproved4.0mm thk veneer with polycoat polish.
BACK - Back side of storage to have 6mm thk. commercial ply with polish finish.
Finishing:-Alltheexternalsurfacesincludingthetopofthestorageunitand exposed woodsurfaces shall be finished with 3.0 mm approved veneer with melaminepolishexceptthetopofthestorageunitwhichshallhave3.0mmthk approved veneer with polycoat polish. Inside visible surfaces complete with
0.8mm thk Laminate. Top to have t.w. moulding finished with high end polycoat polish as instructed. (C ) FULL HEIGHT STORAGE ProvidingandfixingFullheightStorageofht.7'-0"anddepthasspecifiedinthe drawings as per specification below.
Skeleton-madeoutof19mm.Thkplyatendverticals,topand bottomand verticals450mmto600mmCentresasshownindrawingand6mmthkback ply.
SHELVES-19mmThk.Plywoodtopandedgesfinishedin0.8mmthk.Laminate to accommodate file height removable and supported on pins.
SHUTTERS-made out of 19mm thk. ply externally finished in 4.0mm thk.
VeneerwithpolycoatpolishandInternallyfinishedin0.8mmthk.Laminateas shown or directed.
HINGES - Each shutter shall have 100mm long oxidised brass butt hinges.
Mimimum4nos.hingesforeachoftheshutter forFullheightStorage and3 Nos. hinges for each of the shutter for Low Height Storage to be provided.
BOLTS-Flushtowerboltsfrominsideattopandbottomtotheshuttersand magnetic catch fixed top and bottom.
LOCKS - of approved make 4 -lever brass body dead lock with S.S. Key.
HANDLES - 100mm wide handles of brass as approved by the Architect.
SKIRTING-AsinstructedbyArchitect,inplywoodfinishedinapproved4.0mm thk veneer with 3mm lamination .
BACK - Back side of storage to have 6mm thk. commercial ply with polish finish.
Finishing:-Alltheexternalsurfacesincludingthetopofthestorage unitand exposed woodsurfaces shall be finished with 4.0 mm approved veneer with melaminepolishexceptthetopofthestorageunitwhichshallhave4.0mmthk 30 Sq. Mtr. 1 1,840.00 3,55,200.00 highendveneerwith3mmlamination polish.Insidevisiblesurfacescomplete with 0.8mmthk Laminate.Top tohave t.w.moulding finishedwith highend polycoat polish as instructed.
2085 SOFAS: - Providing&SupplyingSofas,Sofachairsofvarioustypes&categories(Single seater, Two seater & Three seater) etc complete as per the manufacturers specificationsasmentionedbelow.Therightstoselect&approvethesofas& seating shall vest with the clients. The contractor shall submit brochures of manufactureratthetimeofquotingforthisitemetc completeas perlayout.
Theconsultantsreservetherighttoselectthesofasinlinewiththetechnical specifications envisaged & meeting the secifications standards expected.
The minimum standards for the Specifications of Sofas shall beas follows: - Inner solid Frame structure made of high quality wood. The wood is kiln chemical treated tropical Meranti wood. The legs are made of rubberwood having melamine matt finish. The seat cushion is made of 7 inches multi layered foam of density 32D 23D 32D and HD with polyester polyfill outer layerof180gsm.Thepolyesterpolyfillkeepstheupholsterywrinkefreeand soft.
Theseatingcushionshave3inchesofelasticwebbingof350gsmwithproper weave. The thread used is nylon bonded to provide lasting stitch strength.
Backrest:2"elasticwebbing(250gsm)withproperWeaveand3"foam(23D) with Polyester polyfill outer layer (180 gsm). Outer finish: stained solid wooden legs superior quality. Frame construction: Kiln seasoned mixed merantisolidtropicalhardwoodSEATWebbing3"properwebbing.Foam:7" MultilayeredfoamsHaving4"ofHighResilience-HDFoamand3"ofHDvirgin PU Foam. BACKREST: Webbing 2" elastic webbing , Foam: 18D PU foam
Upholstery: semi PU with layer of polyester polywadding Stitiching Nylon thread.LegsSolidkilnseasonedandtreatedSolidwoodwith MelamineMatt Finish.
A Leather Sofas i Single Seater Sofas 6.00 No. 4 2,500.00 2,55,000.00 ii Two Seater Sofas 4.00 No. 6 0,000.00 2,40,000.00 B Leatherite Sofas i Single Seater Sofas 14.00 No. 2 5,000.00 3,50,000.00 ii Two Seater Sofas 9.00 No. 4 0,000.00 3,60,000.00 iii Three Seater Sofas 2.00 No. 5 2,000.00 1,04,000.00 iv Three Seater Curved Sofas in designer shape & profile as shown in the Plan 2.00 No. 6 3,500.00 1,27,000.00 v Four Seater Curved Sofas in designer shape & profile as shown in the Plan 1.00 No. 7 5,000.00 7 5,000.00 6 Corner Table ( 1'-6" x 1'-6" ) Providing,Supply&installationofCornertable-MATERIALS&DIMENSION(+/- 2mm) - 600L x 600W x 450H. TABLE MATERIALS & SIZE : TOP : SOLID VENEEREDMDFTABLETOPin18mmthicknessORGLASSTOP10mm.LEGS:
SOLIDRUBBER/MSunderstructure,WOOD.Color:AsApproved.LEGS:Color:
14.00 No. 1 2,500.00 1,75,000.00 As Approved.RESTANYSTDCOLOUR.Therate shallinclude includingglass toptohavebevellededgesincludingbottomglassshelfetccomplete.Therate shall also include all the necessary hardware, fittings, fixtures as per manufactursrs specifications complete.
7 Center Table (Oval / Rectangular) Providing,Supply&installationofCentretable-MATERIALS&DIMENSION(+/- 2mm) as mentioned hereinunder. TABLE MATERIALS & SIZE : TOP : SOLID VENEEREDMDFTABLETOPin18mmthicknessORGLASSTOP10mm.LEGS:
SOLIDRUBBER/MSunderstructure,WOOD.Color:AsApproved.LEGS:Color:
As Approved.RESTANYSTDCOLOUR.Therate shallinclude includingglass toptohavebevellededgesincludingbottomglassshelfetccomplete.Therate shall also include all the necessary hardware, fittings, fixtures as per manufactursrs specifications complete.
a Size of table- 4'-0" x 2'-0" (Oval / Rectangular) 10.00 No. 1 7,000.00 1,70,000.00 8 Providing, Supply & installation of Dining Tables, Rectangular / Circular Shaped to be provided with Commercial Plywood top, 12mm thk and to be finished with Back Painted Glass top with bevelled edges of 10mm thk and supportedusingSSbaseframewithSSlegsandframesupportatthebaseand thetopofthetableleveletccompletesoastoprovideadequatesturdinessto the table. The rate shall also include all the necessary hardware, fittings, fixtures as per manufacturers specifications complete.
a Size-4'0"X3'-0"ExecutiveRectangularTables.Thetableshallhaveacentral cut out ofsize 2'-0" X8"with clear glass topexactly matchingthe leveland alignmentofthebackpaintedGlassandtobe6"deepwithatrayboxbeneath 6.00 No. 2 6,500.00 1,59,000.00 to be filled with artificial planters and white pebbles etc complete.
209b Size-3'0"DiameterCircularTable. Thetableshallhaveacentralcutoutof size8"diameterwithclearglasstopexactlymatchingthelevelandalignment ofthebackpaintedGlassandtobe6"deepwithatrayboxbeneathtobefilled 8.00 No. 2 3,000.00 1,84,000.00 with artificial planters and white pebbles etc complete.
9 CHAIRS Providing & Supplying Chairs of approved make Providing&Supplyingpremiumclass&highendChairsfordifferentcategories withminimumtechnicalspecificationssuchasGaslift,Revolvingtype,Tilting type,castors,armrest,SSsupportsandallfeaturesofexecutivechairsasper the approved makes.The basic specifications,which are to beconsidered as
minimum specifications are as follows: -
Chair Seat: Pneumatic seat height adjustment (16" to 25.5"). Chair padding should allow for distribution of weight to be at a maximum.
ChairBack:Upperbacksupportshouldbeprovidedwithtallbackchairs.The chairbackshouldmakecontactwithindividual'supperbackandlumbar(back )supportasperergonomicprinciples.Backandseatangleadjustmentallow
for neutral positioning : 90-120 degree trunk- thigh angle. Back tension adjustment.Variablebackstopadjustmentonbacktiltmechanismwithlocks in place at various angles.
UPHOLSTERY:Asperdesiredfinish.Theupholsteringtobedonebvmeansof pneumaticgun.Theback&seatedgestobecoveredbyPVCprofilewhichis alsostapledorABSfibrecoversfittedontheback.Thefabricshallbecoated withscotchguardforstainresistance.Chairfabricshouldhaveelasticitythat does not restrict the foam.
Armrests : Fixed Handles of inflexible PUF with cushioned soft armrest and rounded edges.
Mechanism : Sinqle sprinq for full tilt or back tilt 360 deqrees swivel mechanismswithalockinglever.Thecarraigeshallbefibre/metallicpowder coated with five prong legs.(Synchro Gas Tilt)
Castors:5flangeormorestarbase.Twinwheelnyloncastoreachdesignedto sustain weight loadof100Kg.Hardwheel castorsfor carpetand softwheel castors for hard flooring.
The rights to select & approve the chairs shall vest with the clients. The contractorshallsubmitbrochuresofmanufactureratthe timeofquotingfor thisitemetccompleteasperlayout.Theconsultantsreservetherighttoselect the chairs in line with the technical specifications envisaged & meeting the specifications standards expected.
a Providing&supplyingChairsfortheTopManagement-Sr.ExecutiveHighback
2.00 No. 4 5,000.00 9 0,000.00 Chair with Leather finish as per manufacturer specification b Providing&supplyingVisitorsChairsfortheTopManagement-Sr.Executive Medium back Visitors Chair with Leather finish as per manufacturer 7.00 No. 3 6,000.00 2,52,000.00 specification c Providing & supplying Board Room Chairs for the Top Management - Sr.
Executive Medium back Chair with Leather finish as per manufacturer 23.00 No. 4 0,000.00 9,20,000.00 specification d Providing & supplying Executive High back Chairs for Senior Management Executives Premium Leatherite finish as per manufacturer specification 5.00 No. 3 3,000.00 1,65,000.00 (CGM's, GM's & Sr. Executive NPS) e Providing&supplyingVisitorsChairsfortheExecutive-MediumbackChairs for Senior Management Executives Premium Leatherite finish as per 15.00 No. 3 0,000.00 4,50,000.00 manufacturer specification (CGM's, GM's & Sr. Executive NPS) f Providing & supplying Executive High back Chairs for Senior Executives Leatherite finish as per manufacturer specification (DGM's & Secretariat) 8.00 No. 3 0,000.00 2,40,000.00 g Providing&supplyingVisitorsChairsfortheExecutive-MediumbackChairs for Senior Executives Leatherite finish as per manufacturer specification 34.00 No. 2 2,500.00 7,65,000.00 (DGM's, NPS Meeting Room & Secretariat) h Providing & supplying Executive Medium Back Chairs for Workstations includingspares,Nettedtype/fabric/upholsteredfinishaspermanufacturer 52.00 No. 1 2,000.00 6,24,000.00 specification i Providing&supplyinghighendDiningchairswithSSsupportsinvibrantcolor
32.00 No. 5 ,000.00 1,60,000.00 combinations 210j Providing & supplying Executive Dining Chairs Upholstered type including
24.00 No. 1 0,000.00 2,40,000.00 spares with SS supports as per manufacturer specification k Providing&supplyingHightedtypeDiningChairsfor LunchCounter infibre board with vibrant color combinations includingspares with SS supports as 5.00 No. 7 ,500.00 3 7,500.00 per manufacturer specification l Providing & supplying Miscellaneous Low Back General Chairs for Drivers room,Rest roometc includingspares withSSsupportsas permanufacturer 10.00 No. 4 ,000.00 4 0,000.00 specification GRANDTOTALCOST OFSCHEDULE II- MODULARLOOSE FURNITURE WORKS (SUM TOTAL OF ALL THE ABOVE Rs. 1 ,09,64,300.00 ELEMENTS) FOR M/s SHETGIRI & ASSOCIATES 211PROPOSED ELECTRICAL INSTALLATION, L.V & SECURITY SYSTEM WORKS FOR PROPOSED OFFICE OF PFRDA, 16TH FLOOR, MAKER TOWERS - F, CUFFE PARADE, MUMBAI SUMMARY STATEMENT OF ELECTRICAL INSTALLATION, LV, UPS & HVAC WORKS S.NO DESCRIPTION OF WORKS AMOUNT IN (Rs.) 1 Electrical work Rs.
12460476.00 Networking 2 Fire Addressable system Rs. 1347518.377 3 Public Addressable system Rs. 1023886.95 4 Access Control System Rs. 1153292.71 5 CCTV & Other L.V Systems a CCTV System - IP Base Rs. 740334.78 Novac System for Server room - Not Included in the Estimation(UsuallyrecommendedforhighendServerrooms / Data centers. As such, not suggested for implementation.
However if to be taken up separately if required) b Water Leakage Detection - Not Included in the Estimation (Usually recommended for high end Server rooms / Data centers.Assuch,notsuggestedforimplementation.However if to be taken up separately if required) c Very Early Smoke Detection system - Not Included in the Estimation(UsuallyrecommendedforhighendServerrooms / Data centers. As such, not suggested for implementation.
However if to be taken up separately if required) d Rodent Repellant - Not Included in the Estimation (Usually recommended for high end Server rooms /Data centers.As such, not suggested for implementation. However if to be e taken up separately if required) AVSolutionIncludingconferencingmeetingdiscussionroom Not considered in the summary of with display units - Not Included in the Estimation (Would costs. Enclosed separately and require detailed discussions. As such, Estimates drawn, would require detailed however cost not included herein and to be taken up by discussions.
6 separately) Sprinkler System (THE SAID ESTIMATE HAS NOT BEEN Not considered in the summary of CONSIDERED IN THE SUMMARY OF COSTS & costs. Reason for the same is IMPELEMENTATIONTHEREIN.THEREASONFORTHESAME mentioned herein IS THAT FIRE FIGHTING SYSTEMS ESPECIALLY FIRE SPRINKLERSWITHIN THE PREMISESDOESNOT EXISTAND ASSUCHAPPROVAL/CONSENTFROMTHESOCIETYWOULD BE REQUIRED FOR IMPLEMENTATION OF THE SAID WORKS) 7 9 HVAC - VRV for all areas of the Office premises Rs. 6 5,54,160.00 Server Room - Precision Units (W+S) - Not Included in the Estimation (To be taken up separately if required)
Total of all the above Works: Rs. 2 ,32,79,668.82 GRANDTOTALCOSTOFELECTRICALINSTALLATION,LV,UPS& Rs. 2 ,32,79,668.82 HVAC SYSTEMS WORKS (Rs.) FOR M/s SHETGIRI & ASSOCIATES 212shetgiri and associates ESTIMATE FOR ELECTRICAL WORKS FOR PROPOSED OFFICE OF PFRDA, 16TH FLOOR, MAKER TOWERS - F, CUFFE PARADE, MUMBAI S. No. DESCRIPTION UNIT QTY RATE AMOUNT MCCB NEAR ENERGY METER Supply & Installation of 315A,4Pole, 25KA MCCB in a fabricated IP 65 1 enclosure near Energy Meter ( MCCB should not visible to outside). (space for Nos 1 .00 3 0,000.00 3 0,000.00 315A 25KA MCCB) Supply & Installation of 160A,4Pole, 25KA MCCB in a fabricated IP 65 2 enclosure near Entrance / Second Entrance ( MCCB should not visible to Nos 1 .00 1 6,000.00 1 6,000.00 outside).
Supply, installation, testing &commissioning of 14SWG(2mm thick) CRCA fabricated&powdercoatedafter7tankprocess,compartmentalized panel withairventilation&dust/verminproof,freestanding,floormountedon100 3 mm rigid 'C' MS base supported on concrete base with anchor fasteners, internal wiring, danger board,rubbermats2 earthing legs, cablechamber etc as per drawing approved by Architect/Consultant / Bank Panelstobe top/ bottom entry& accessible from front & rear side or as required by consultant & site conditions. GA to be made by contractor & approvedbyconsultant/EngineerInchargePriortofabricationwithrespect toSLD&spec.BusbartobeofelectrolyticAlu withcurrentdensityof1.0amp persqmm orasmentionedforcopperPanelshallconfirmtoallapplicableIS standards.thermalmagneticbasedMCCBtobeused.APFC,UPSpanelstohave DcurveMCB.AllinternalwiringtobedoneinpvcinsulatedFRLScopperwires OutgoingfromMCCBtobeterminatedinbusbars/panelconnectorsincable Chamber. All terminations to have Bi-metallic strip/washer as required .
All MCCBtohavespreaderlinksuptocablechamberMCB DB.ALLDB'stobe IP43. AllMCBtobe'C'&'D'curve asmentioned& indicatorstobeLEDAll MCB & DB to be approved by consultant before procurement. Panel manufacturer must be CPRI approved. EARTH BUS CHAMBER TO BE CONSIDER AT TOP/BOTOOM as per drawing approved by Architect/Consultant / Bank a MAIN LT panel 1 No 4 ,00,000.00 4 ,00,000.00 INCOMER -1 315AFP25KA ThermalMagnetic basedMCCBwithO/C,S/C&E/F- 01No.
withMultifunctionmeter,RYBLEDindication,ON-OFF-TRIPindicationswith 2Amp MCB. (space for 315A FP 25KA MCCB) 3Nos,CT-315A/5A,0.5CL1.0,Indicationlampwith2AMCB,connectedwith MFM meter etc. & 1 no CT set for APFC relay BUSBARS SECTIONS 315 amps FP busbar, chamber of suitable length with AL busbars. Insulated with heat shrinkable color coded sleeves.
OUTGOING:- 250A ,25KA, Thermal Magnetic based FP MCCB-03nos for AC VTPN, APFC panel, spare.
150 A , FP MCCB-1 nos UPS input.
63 A , FP MCB-3 nos Work station, Light,Spare.
APFC [105 KVAR ] [current & contactor based] 250A, 4P, MCCB as incomer a) 12 Stage Relay, Auto/ Manual switch, ON/OFF indicator b) 16A, 3P, MCB,10kA-8No b c) 63A, 3P, MCB,10kA-4No Nos 1 .00 1 ,50,000.00 1 ,50,000.00 d) 18A 3P, Power contactor -8Nos e) 70A 3P, Power contactor -4Nos f) 2 KVAR-2 Nos, ,5 KVAR-2Nos 10 KVAR-2Nos, 25 KVAR-3Nos Nos (Through Contactor) CHANGEOVER SWITCH(COS):
4 SITC of fabricated 250A ,4 pole on load Change over switch with provision for Nos - 2 5,000.00 - the service cable termination as required.
Supply, Installation, Testing & Commissioning of Distribution Boards recessed in walls/partitions, complete with MCBs/ Bus bars and interconnections. No 5 fabricated DBs shall be allowed. Only DBs of specified makes as per list of materials shall be used (DOUBLE DOOR IP43 Type) 12 WAY VTPN (MCCB DB) as follows : (Essential DB UPS Lighting & UPS power) a Nos 1 .00 4 0,000.00 4 0,000.00
Incomer: 150A 4P, 25kA, MCCB-1nos,
Outgoings:63A TP MCB - 08 Nos, 6A-32A SP MCB-6 Nos., Blank plates Page 2 of 19 213shetgiri and associates S. No. DESCRIPTION UNIT QTY RATE AMOUNT 12 WAY VTPN (MCCB DB) as follows :(AC DB)
b Incomer: 200A 4P, 25kA, MCCB-1nos, Nos 1 .00 4 5,000.00 4 5,000.00
Outgoings: 63A TP MCB-8 Nos, Blank plates.
12-way TPN DB (7 Segment DB) -Double Door -(Horizontal type) with 63A, 4P, MCB as incomer, 63A DP ELCBs, 100mA -3Nos and 6-10A SP MCB-18 Nos, c Nos 4 .00 3 7,000.00 1 ,48,000.00 16A-20A SP MCB- 3 Nos, 32A- 40A SP MCB 3 Nos as out going, blank plates 6-way TPN DB -Double Door -(Horizontal type) with 63A, 4P, MCB as incomer d Nos 6 .00 2 5,000.00 1 ,50,000.00 and 6-10A SP MCB-18 Nos as out going 2+6 way SPN MCB with metal Double door DB for UPS sockets. 100A DP MCB-1No as Input, 6-32A SP MCB-5No ( Hub/NETWORK RACK,CCTV, Fire e Nos 4 .00 5 ,600.00 2 2,400.00 panel, Burglar alarm and Distribution boards in office) (UPS Output DB) 2+10 way SPN MCB with metal Double door DB for UPS sockets. 32A DP f Nos 6 .00 6 ,000.00 3 6,000.00 MCB-1No as Input, 6-32A SP MCB-10No tables and Manger Cabin 2+4 way SPN MCB with metal Double door DB for UPS sockets. 32A DP MCB- g Nos 3 .00 5 ,000.00 1 5,000.00 1No as Input, 6-32A SP MCB-4No as out going Supply&Installationof150A 4PMCCB with suitableenclosure (UPSOUT h Nos 3 .00 15,000.00 45,000.00 PUT) Supply&Installationof 150A 4P MCCB with suitableenclosure (UPSIN i Nos 3 .00 15,000.00 45,000.00 PUT) Supplyandfixing of 25A/ 32A DP MCBona suitable metalbox for power j supply to A/C units including all interconnections as required near the Nos 5 0.00 1,900.00 95,000.00 proposed AC locations at 4.5ft from the floor level.
Supply,Installation,testingandcommissioningof63A,4P,100mARCCBwith k Nos 2 .00 5,530.00 11,060.00 suitable weather proof IP65 enclosure etc.
Supply & Laying of following 1100V grade armored cable having sector /
circular shaped aluminum conductor XLPE insulated cores, laid up, PVC tape wrapped inner sheathed, GI strip / wire armored and overall extruded PVC 6
sheathed confirming to IS: 7098, laid along with 2 Runs of 12 SWG GI Wire on wall or ceiling using GI clamps and spacers as per route shown at site and further as directed by Bank / Architect. a 3.5 CX 300 Sq.mm Al Cable along with 2 Runs of 12 SWG GI wire Rmt 9 6.00 2 ,000.00 1,92,000.00 b 3.5 CX 185 Sq.mm Al Cable along with 2 Runs of 12 SWG GI wire Rmt 1 92.00 1 ,750.00 3,36,000.00 c 3.5 CX 120 Sq.mm Al Cable along with 2 Runs of 12 SWG GI wire Rmt 2 40.00 1 ,200.00 2,88,000.00 d 3.5 CX 70 Sq.mm Al Cable along with 2 Runs of 12 SWG GI wire Rmt 1 12.00 1 ,050.00 1,17,600.00 e 3.5 CX 50 Sq.mm Al Cable along with 2 Runs of 12 SWG GI wire Rmt 1 28.00 9 00.00 1,15,200.00 e 4CX 16 Sqmm, CU cable along with 2 Runs of 12SWG GI Wire Rmt 2 40.00 6 00.00 1,44,000.00 f 4CX 10 Sqmm, CU cable along with 2 Runs of 12SWG GI Wire Rmt 1 44.00 5 30.00 76,320.00 g 4CX 6 Sqmm, CU cable along with 2 Runs of 12SWG GI Wire Rmt 3 44.00 3 70.00 1,27,280.00 h 3CX 6 Sqmm, CU cable along with 2 Runs of 12SWG GI Wire ( UPS) Rmt 2 40.00 2 90.00 69,600.00 i 3CX 4 Sqmm, CU cable along with 2 Runs of 12SWG GI Wire ( Split AC) Rmt 2 00.00 2 40.00 48,000.00 j CAT 6A cable Rmt 2 ,200.00 1 50.00 3,30,000.00 Supply & end termination of following cables including compressed type brass 7 glands, crimping type Aluminum/ copper lugs, insulation tape etc. as required complete with earthing of glands in following sizes a 3.5 CX 300 Sq.mm Al Cable along with 2 Runs of 12 SWG GI wire Nos 4.00 500.00 2,000.00 b 3.5 CX 185 Sq.mm Al Cable along with 2 Runs of 12 SWG GI wire Nos 4.00 300.00 1,200.00 c 3.5 CX 120 Sq.mm Al Cable along with 2 Runs of 12 SWG GI wire Nos 4.00 300.00 1,200.00 d 3.5 CX 70 Sq.mm Al Cable along with 2 Runs of 12 SWG GI wire Nos 4.00 200.00 800.00 e 3.5 CX 50 Sq.mm Al Cable along with 2 Runs of 12 SWG GI wire Nos 4.00 200.00 800.00 e 4CX 16 Sqmm, CU cable along with 2 Runs of 12SWG GI Wire Nos 4.00 100.00 400.00 f 4CX 10 Sqmm, CU cable along with 2 Runs of 12SWG GI Wire Nos 4.00 100.00 400.00 g 4CX 6 Sqmm, CU cable along with 2 Runs of 12SWG GI Wire Nos 4.00 100.00 400.00 h 3CX 6 Sqmm, CU cable along with 2 Runs of 12SWG GI Wire ( UPS) Nos 4.00 100.00 400.00 i 3CX 4 Sqmm, CU cable along with 2 Runs of 12SWG GI Wire ( Split AC) Nos 4.00 100.00 400.00 j CAT 6A cable complete with face plate and all other accessories Nos 275.00 300.00 82,500.00 Page 3 of 19 214shetgiri and associates S. No. DESCRIPTION UNIT QTY RATE AMOUNT 8 SUB MAIN WIRING Supply & Wiring with Flame Retardant Insulated PVC copper wire as per gradeIS994forCircuits,Computerpoint,Powerpointswithin2mmthickPVC conduits where it is concealed and heavy gauge GI conduits where it is exposed with necessary accessories and with proper clamps and to be concealed below the false ceiling. It comprises as follows:- 2Runs of 4Sqmm copper wire+ 1x 2.5 Sqmm copper wire in PVC conduit a Rmt 300.00 140.00 42,000.00
(AC) b 2Runs of 4Sqmm copper wire+ 1x 2.5 Sqmm copper wire in GI conduit Rmt 400.00 300.00 1,20,000.00 2Runs of 10 Sqmm copper wire+ 1x 6 Sqmm copper wire in PVC conduit (UPS c Rmt 120.00 225.00 27,000.00 ) 2Runs of 10 Sqmm copper wire+ 1x 6 Sqmm copper wire in GI conduit (UPS ) d Rmt 750.00 140.00 1,05,000.00 Supplyingandlaying3CX2.5Sq.mm1100VgradePVCinsulatedFlexiblecable e alongwithonerunof12SWGGIearthwireinPVCpipesrunonwall/Ceiling Rmt 1 80.00 300.00 54,000.00 etc. as required. (for sign board ) EMERGENCY LIGHTING(UPS SUPPLY) Supply&layingof3core1.5sqmmcopperflexiblecableinasuitableFRLS PVCpipeforemergencylighting.Thescopeofworkincludessupply&fixing F of2A DP MCB in a suitable enclosure. No of points :One primary point & Nos 30.00 9,500.00 2,85,000.00 Threesecondarypoints.Thescopeofworkextendstosupply&fixingof4no of square / round type 15 watts recess mounted LED lights also.
9 MODULAR SOCKETS FOR UPS & RAW POWER Supply and fixing of 2nos. 6A sockets fixed Above the table with 2 no 6A switch fixed above the table on suitable module metal box and white front plate (Modular type) with 2runs of 2.5 sq.mm FRLS and 1 run of 1.5sqmm FRLS 1100 V grade PVC insulated multi strand copper conductor wires a conforming to IS 694 (with latest amendments) with 25mm dia PVC conduit of Nos 20.00 1,645.00 32,900.00 2mm thick concealed in wall/floor and supply of all fixing materials and accessories, interconnections complete as required for the raw power primary sockets (DB to work stations Primary point)(UPS Point) Supply and fixing of 3nos. 6A sockets fixed Above the table with 1 no 16A switch fixed above the table on suitable module metal box and white front plate (Modular type) with 2runs of 2.5 sq.mm FRLS and 1 run of 1.5sqmm FRLS 1100 V grade PVC insulated multi strand copper conductor wires b conforming to IS 694 (with latest amendments) with 25mm dia PVC conduit of Nos 145.00 3,000.00 4,35,000.00 2mm thick concealed in wall/floor and supply of all fixing materials and accessories, interconnections complete as required for the raw power primary sockets (DB to work stations Primary point)(UPS Point) Supply and fixing of 2nos. 6A sockets fixed Above the table with 1 no 16A switch fixed above the table on suitable module metal box and white front plate (Modular type) with 2runs of 2.5 sq.mm FRLS and 1 run of 1.5sqmm FRLS 1100 V grade PVC insulated multi strand copper conductor wires c conforming to IS 694 (with latest amendments) with 25mm dia PVC conduit of Nos 145.00 2,000.00 2,90,000.00 2mm thick concealed in wall/floor and supply of all fixing materials and accessories, interconnections complete as required for the raw power primary sockets (DB to work stations Primary point)(Raw Point) Supply and fixing of 1nos. 6A sockets fixed Above the table with 1 no 6A switch fixed above the table on suitable module metal box and white front plate (Modular type) with 2runs of 2.5 sq.mm FRLS and 1 run of 1.5sqmm FRLS 1100 V grade PVC insulated multi strand copper conductor wires d conforming to IS 694 (with latest amendments) with 25mm dia PVC conduit of Nos 120.00 1,400.00 1,68,000.00 2mm thick concealed in wall/floor and supply of all fixing materials and accessories, interconnections complete as required for the raw power primary sockets (DB to work stations Primary point)(Raw Point) same as above but looped from nearest Raw Power point (Primary point to Secondary point) including 2nos. 6A sockets fixed Above the table with 2 e no 6A switch fixed above the table on 3 module metal box and white front Nos 18.00 1,100.00 19,800.00 plate (Modular type)with 2runs of 2.5 sq.mm FRLS and 1 run of 1.5sqmm
PRIMARY POINT: RAW POWER Supplyandfixingof1noof16Asocketwith1noof16Aswitchonsuitable ModularmetalboxandmodularfrontplateincludingSupply andwiringwith 2runsof4.0sq.mm &onerunof2.5sqmm1100VgradePVCinsulated f multistrandFRLScopperconductorwiresconformingtoIS694(withlatest Nos 40.00 2,200.00 88,000.00 amendments) with 25mm dia PVC conduit of 2mm thick concealed in wall/floorandsupplyofallfixingmaterialsandaccessories,interconnections complete as required for the UPS/ raw power sockets etc. (No Loop point) Page 4 of 19 215shetgiri and associates S. No. DESCRIPTION UNIT QTY RATE AMOUNT
PRIMARY POINT: RAW POWER Supplyandfixingof1noof6A/16Asocketwith1noof6A/16Aswitchon suitable Modular metal box and modular front plate including Supply and wiringwith 3runsof2.5sq.mm 1100VgradePVCinsulatedmultistrand g FRLScopperconductorwiresconformingtoIS694(withlatestamendments) Nos 120.00 1,850.00 2,22,000.00 with25mmdiaPVCconduitof2mmthickconcealedinwall/floorandsupply ofallfixingmaterialsandaccessories,interconnectionscompleteasrequired for the AC VRF IDU sockets etc.
SECONDARY POINT: RAW POWER (Primary point to Secondary point)
Sameasaboutbutloopingfromtheabovepoint:Supplyandfixingof1noof 6A/16Asocketwith1noof6A/16AswitchonsuitableModularmetalbox and modular front plate including Supply and wiring with 3 runs of 2.5 h sq.mm1100VgradePVCinsulatedmultistrandFRLScopperconductorwires Nos 28.00 1,250.00 35,000.00 conforming to IS 694 (with latest amendments) in suitable size FRLS PVC Conduitof2mmthickconcealedintheaboveductsinthefloorandsupplyof allfixingmaterialsandaccessories,interconnectionscompleteasrequiredfor the AC VRF IDU sockets etc.
PRIMARY POINT: RAW POWER Supply and fixing of 2 Nos of 16A socket with 2 Nos of 16A switch on suitable Modular metal box and modular front plate including Supply and wiringwith 2runsof4.0sq.mm &onerunof2.5sqmm1100VgradePVC i insulated multi strand FRLS copper conductor wires conforming to IS 694 Nos 32.00 2,700.00 86,400.00 (with latest amendments) with 25mm dia PVC conduit of 2mm thick concealed in wall/floor and supply of all fixing materials and accessories, interconnectionscompleteasrequiredfortheUPS/rawpowersocketsetc.
(No Loop point)
Primary:Supply &Installation ofpoint wiringfor UPSor stabilizedpower plugpointsonworkstations/tableforcomputersusing3CX2.5Sqmm FR sheathed WHITE/BLACK color flexible cable with 25mm dia PVC conduit of 2mm thick concealed inwall/floor/ partitions. Each point consisting of3 j nosof5A,2/3pinsocketsbelowtabletop&1No.,15ASwitchabove Nos 18.00 2,200.00 39,600.00 tabletop,PVCConduitswiredtogetherformingonepoint.Theearthwire of 3 core flexible cable to be of yellow-green color only. (ONLY Two tables served by one circuit from DB)
Secondary:Supply&InstallationofpointwiringforUPSorstabilizedpower plugpointsonworkstations/tableforcomputersusing3CX2.5Sqmm FR sheathed WHITE/BLACK color flexible cable with 25mm dia PVC conduit of 2mmthickconcealedinwall/floor/metalpartitions.Eachpointconsisting k of3nosof5A,2/3pinsocketsbelowtabletop&1No.,15ASwitchabove Nos 18.00 1,800.00 32,400.00 table top, wired together forming one point. The earth wire of 3 core flexiblecabletobeofyellow-greencoloronly.(ONLYTwotablesservedby one circuit from DB) Supply&InstallationofpointwiringforUPSorstabilizedpowerplugpoints on workstations / table for computers using 3C X2.5 Sqmm FRsheathed WHITE/BLACK color flexible cable with 25mm dia PVC conduit of 2mm thick concealed in wall/floor/metal partitions. Each point consisting of2 l Nos 20.00 2,850.00 57,000.00 nosof5A,2/3pinsockets&1No.,15ASwitch,wiredtogetherforming onepoint.Theearthwireof3coreflexiblecabletobeofyellow-greencolor only. (ONLY Two tables served by one circuit from DB) Providing3meterlengthofflexible3core2.5sqmmmulticorecoppercable oneendconnectedtoplugtop15AandtheotherconnectedtotheSBinside m andasuitablehookarrangementasrequiredforhangingthecable(Thisitem Nos 6.00 620.00 3,720.00 excludes wiring from DB to Socket and socket to inside switch box which already considered in point wiring) Supplyandfixingof1nos.16Asocketwith1no16Aswitchfixedona3module metalboxandwhitefrontplate(Modulartype)includingallinterconnections n Nos 6.00 600.00 3,600.00 as required for locker, safe room, Record room/Stationary room.
Page 5 of 19 216shetgiri and associates S. No. DESCRIPTION UNIT QTY RATE AMOUNT 10 LIGHT & FAN POINT WIRING SupplyandwiringforPrimarylightpointwith2Runsof1.5sq.mm+1Runof
1.5Sqmm(Earth)650VgradePVCinsulatedCopperConductormultistrand wiresinheavygauge20/25mmdiaPVCconduitofapprovedqualityalong with required accessories when laid on ceiling / below work stations and fixingof5AmpModulartypeswitchinanodizedGIboxcompletewithfront plate,supplyingandfixing3wayceilingroseorstraight/slantbattenholder includinginterconnectionsrequired.Therateshallincludecircuitwiring with2runsof2.5sq.mmmultistrandcopperconductorwire&1runof
1.5sq.mm wire for earth in suitable size heavy gauge 25mm dia PVC conduitfromDBtoswitch&switchboardtoswitchboard,ceilingrose and angle holders for cfl light fixtures all complete. a Primary points Pts 7 50.00 750.00 5,62,500.00 b same as above but for Extending the existing point in the office room Pts 4 50.00 500.00 2,25,000.00 Supply and installation of 6A modular socket with a switch in the above c Nos 2 00.00 350.00 70,000.00 modular switch boards.
Wiring for the wall mounting fans from the nearest switch board with
1.5sqmm 650V grade multistranded PVC insulated copper wire in PVC Conduit d and all interconnections as required including the supply and fixing of 6A Nos 5 .00 750.00 3,750.00 modularsocketnearthewallmountedfanand6Aswitchinthenearswitch board below fan as required.
SupplyandwiringsimilartoitemabovebutforceilingfanpointincludingGI e box and 5 Amp. Control switch, 100W step type Electronic fan regulator etc. Nos 6 .00 990.00 5,940.00 11 FLOOR TRENCH BOXES / CABLE TRAYS SupplyandlayingRaceways/Conduits(forunderfloortrenches/Ontrays) onexistingflooring.Raceways/conduitsshallbefixedtotheflooringwithGI clampsforfinishedlevelsasperthesiteconditionsorthroughpartitionswith allaccessories.Therateshallincludepreparationoftrenchesofrequiredsizes by carefully removing the malwa on existing floor for laying Raceways/conduits for power, data, telephone cablesetc. The depth ofthe trenchesshallbeatleast2inchesfromthefinishedfloorleveloruptoRCCof theslab.Therateshall includethecostoftheRaceways/conduits.Therate shall also include the activity of clearing the debris generated from the preparation of trenches & filling the same with PCC.
a 80 x 40 x 1.6mm thick Aluminium Raceways Rmt 650.00 2 90.00 1,88,500.00 b 60 x 40 x 1.6mm thick Aluminium Raceways Rmt 500.00 2 60.00 1,30,000.00 Supply & Laying of following size PVC conduit of 2mm thick concealed in 12 wall/floor with all accessories, bends, pull wire etc. For CCTV and LAN 25 mm Heavy gauge PVC Conduit Rmt 900.00 60.00 54,000.00 Supply&Installation of floor junction boxeswith 2mm thickremovable coverplatescrewedonallfoursidesofM.S.sheet,fullypowdercoated for above raceways, of following sizes, fabricated out of M.S. sheets, fully powdercoatedwithprovisionforremovableM.S./S.S.screwedcoverplates 13 onallfoursidesforblockingtheentryintothejunctionbox.Allthejunction boxestobe(withstud)'properlyearth-bondedwiththeracewayspipeusing 12 SWG Copper bare wire as directed at site.
a size 250mm x 250mm x 50mm x 2.5mm thick Nos 60.00 900.00 54,000.00 b size 300mm x 300mm x 50mm x 2.5mm thick Nos 75.00 1,500.00 1,12,500.00 14 LED LIGHT FIXTURES ( COMMERCIAL TYPE ONLY) /FANS Supply & Installation of 36W 2'X2' LED Light fixtures (WIPRO CRCO24RO36HP65G22X236W3600LUMENSorPhilipsorEqualentmodels inotherapprovedmakes)includingcostandconveyanceofallmaterials,taxes a Nos 130.00 2,000.00 2,60,000.00 andalllaborchargesetc.,complete.Weightofthelightshouldnotbeonthe grid/Gypsumceiling.lighthastobefixedwiththehelpofGI/chainwiresand to the anchored to the ceiling.
Supply&Installationof 610x610LedLightfixturesFramesincludingcostand b conveyance of all materials, taxes and all labor charges etc., complete Nos 1 30.00 900.00 1,17,000.00 Supply&Installationof15WLEDdownlightfixture.(WiproLD06MOLLIS 15W or Philips or equivalent models in other make) including cost and c Nos 1 25.00 750.00 93,750.00 conveyance of all materials, taxes and all labor charges etc., complete.
Supply & Installation of 3W LED down light fixture of approved make d includingcostandconveyanceofallmaterials,taxesandalllaborchargesetc., Nos 1 0.00 500.00 5,000.00 complete.
Page 6 of 19 217shetgiri and associates S. No. DESCRIPTION UNIT QTY RATE AMOUNT Cove / Indirect Lighting & Other Area Lighting Supply & Installation of single color (warm white 2800k light / any other approved color) flexible LED strip light including required rated driver / power supply inmultiplesof 1Rmtrasapprovedbycategory&modelsin otherasapprovedmakebyclient/architect/Engineer.) includingcostand d Rmt 450.00 250.00 1,12,500.00 conveyance of all materials, taxes and all labor charges etc., complete.
(DF42827240 LEDPER METER2700K LEDSTRIP WIPROWITH1METER ALUMINUM PROFILE AND DRIVER FOR 5 METER ) SupplyandInstallationof20WBattenLEDlightfixturesSURFACEtypewith e all interconnections and fixing arrangement as required. (LL20-221-XXX- Nos 1 0.00 650.00 6,500.00 65NE3 20W 6500K BATTEN or equivalent) WALL MOUNTING FANS SupplyandFixingof18inchMetalbody&Bladeswallmountedfanswith3pin f Nos - 4,200.00 QRO plug top, fan body should be earthed if 3 pin socket not available in the market, Make: Storm model in CG or equivalent
EXHAUST FAN:- Supply&Installationof freshairexhaustfan50Woflightduty300mmsize g (12"),Metallicbody&blades,wiremesh,birdlouversetc.includingcostand Nos 1 2.00 1,850.00 22,200.00 conveyance of all materials, taxes and all labor charges etc., complete for eraction
CEILING FAN:- supply &Fixing of 1200mm sweep 5 star High speed ceiling fan with electronic step regulator in suitable locations as required. And Supplying of double h anchor fastener hooks and down rods . complete in all respects as directed by Nos - 3,500.00 QRO Bank. Ref Model : Crompton Greaves Rivera high speed model (or) equivalent in other approved make SUPPLY & FIXING OF EXHAUST FANS WITH TIMER Supply&fixingof2noofbirdcageexhaustfanswithtimercontrolforthe i exhaust fans in the UPS room. The scope of work includespoint wiring & Nos 2 .00 4,600.00 9,200.00 makingprovisioninthewallforinstallationofexhaustfansandbringbackto original finish.
Profilelight:22/23WLEDlight4'x6"Min.2800LUMENsystemo/psealess stril(lime) light complete with controller / balast acrelic sheets with max. j Rft 6 50.00 650.00 4,22,500.00 efficiencyfor lightingof approvedequalinquality&design (techzoneLED fitting 150mm x 1200mm) k Bracket light (wall light) Nos 2 0.00 1,500.00 30,000.00 L Decorative light (Basic rate Rs. 15000) Nos 1 0.00 15,200.00 1,52,000.00 15 TELEPHONE & LAN CABLING Supply, laying and connection of high Conductivity Solid Annealed Bare Copperindustrial2Pair0.5sqmmdiaTelephoneCableswithHighDensity Polyethylene Insulation, Paired, Polyester and Sheathed with High Oxygen Index, Fire Retardant, PVC Compound, Grey Outer Sheath generally a conforming ITD Specification. the scope of work inclusive of all fixing Nos 2 00.00 1,000.00 2,00,000.00 accessories & laying ina suitable ISI medimum PVC conduit. The scope of work extendstoSupply andFixing of modular type RJ11 Telephone outlet with anodized GI box and front plate complete as required.
Supply,installation,testing&commissioningof10PairTelephoneKroneDB b Nos 4 0.00 1,200.00 48,000.00 in an MS powder coated enclosure in suitable location Data Networking Points & Gadgets (1 Lot is considered for all the three c Lot 1 .00 5,00,000.00 5,00,000.00 Premises under reference) 16 EARTHING
COPPER EARTHING:
Providingindependentearthingforsophisticatedelectronicequipmentwith 600mmx600mmx3.5mmthickcopperplaterigidlyfixedto40mmdiaG.I. pipe of 3 mtr length connected with reducer providing .GI. funnel with wiremeshaspernationalelectriccodeincludingC.C.Chamberofsize400mm a Nos 3 .00 13,500.00 40,500.00 x400mmx400mmcoveredwithRCCslabfillingwithsaltandcharcoalgiving earthconnectionfromelectrodecopperstrip 2runsof50mmx6mmx3000 mm length with all accessories and labour charges complete, as per IS specifications 732/1982 (Part II)
GI EARTHING:
Providingindependentearthingforimportantequipmentwith40mmdia"B" class 2.5m long G.I pipe and 19mm dia "B" class G.Ipipe of 0.3 mtr. Long connected with reducer providing G.I. funnel with mesh enclosed in C.C.
b Chamberof400mmx400mmx400mmwithRCCslabcoverdulyproviding Nos 3 .00 7,500.00 22,500.00 staggered holes filling with salt and charcoal from the bottom of the pipe givingearthconnectionfromelectrodethroughG.I.strip2runsof50x6mmx 3000mmlengthwithallaccessoriesandlabourchargescomplete,asperIS specifications 732/1982 (part II) S.I.T.C. of 25 x 3 CU Strip through PVC sleeve (Electrical Earthing) (From c Rmt 80.00 5 00.00 40,000.00 Electrical Earthing Pit to Main Electrical Earthing Busbar) Page 7 of 19 218shetgiri and associates S. No. DESCRIPTION UNIT QTY RATE AMOUNT S.I.T.C. of 25 x 5 GI. Strip through PVC sleeve (Electrical Earthing) (From d Rmt 60.00 1 20.00 7,200.00 Electrical Earthing Pit to Main Electrical Earthing Busbar) Supply & Laying of 100mmX 25mmX 5mm Copper strip with supporting e Nos 2 .00 500.00 1,000.00 insulator and holes Preparationof"shopdrawings"and"ASBUILT"andgettingitapprovedfrom 17 Job 1 .00 35,000.00 35,000.00 architect consultant and client.
18 Warranty: 1+2 years - Not covered since the Works would be under DLP Lot - 5,00,000.00 QRO UPS OF 25 KVA/20 KW High Performance IGBT/PWM based 3 PHARE INPUT / OUTPUT INCLUSIVE OF BATTRIES / DC SWITCH GEARS AND ALL 19 Nos. 1.00 7,50,000.00 7,50,000.00 ACCESSORIES COMPLETE FOR SUCCESSFUL FUNCTIONING OF THE SYSTEM.
(Server) True-On-Line Double Conversion Microprocessor Controlled UPS system with 30min. Backup on 20 KW load Each 25KVA UPS system consisting of:
100% Capacity IGBT rectifier. (Input Power factor >0.99, Input THDi <3% ) Output power factor = 0.9 100% Capacity Static IGBT- Inverter.
100% Capacity Static Bypass Switch.
ECO Mode for efficiency upto 98% Inbuilt Standard potential free contacts / modbus for online monitering.
Inbuilt Standard programmable Battery test & Battery Management Software.
Inbuilt LCD Display for fault diagnostic Input Reverse phase sequence protection circuitry.
Battery: provide details.
Make: Amara Raja (Quanta) / Rocket / exide eq.
With battery racks, interconnecting links, with UPS connecting switch MCCB ,BCB and DC cable (10Mtrs).
UPS OF 40KVA/36 KW High Performance IGBT/PWM based 3 PHARE INPUT / OUTPUT INCLUSIVE OF BATTRIES / DC SWITCH GEARS AND ALL Nos. 1.00 9,25,000.00 9,25,000.00 ACCESSORIES COMPLETE FOR SUCCESSFUL FUNCTIONING OF THE SYSTEM.
20 (lighting + power) True-On-Line Double Conversion Microprocessor Controlled UPS system with 30min. Backup on 36 KW load Each 40KVA UPS system consisting of:
100% Capacity IGBT rectifier. (Input Power factor >0.99, Input THDi <3% ) Output power factor = 0.9 100% Capacity Static IGBT- Inverter.
100% Capacity Static Bypass Switch.
ECO Mode for efficiency upto 98% Inbuilt Standard potential free contacts / modbus for online monitering.
Inbuilt Standard programmable Battery test & Battery Management Software.
Inbuilt LCD Display for fault diagnostic Input Reverse phase sequence protection circuitry.
Battery: provide details.
Make: Amara Raja (Quanta) / Rocket / exide eq.
With battery racks, interconnecting links, with UPS connecting switch MCCB ,BCB and DC cable (10Mtrs).
21 Miscellaneous Works A Data Networking Works i Supply,Installation,Testing and Commissioning of Cat 6 A Cable 2,655 Mtr. 70 1,85,850 Supply,Installation.Testing and commissioning of 25MM. PVC Conduit with 300 Mtr. 54 16,200 ii accesorries Supply,Installation.Testing and commissioning of Cat-6 Socket with I/O 300 Nos. 984 2,95,200 iii Termination Supply,Installation.Testing and commissioning of Telephone Socket with I/O 300 Nos. 984 2,95,200 iv Termination Termination, Testing, Scanning, Certification and Documentation of UTP 300 Nos. 259 77,760 v Points vi 10 pair Krone Box of Suitable Sizes 10 Nos. 900 9,000 B Automation Sensors Supply, installation, testing and commissioning of Dali Dimmable Ballast for 75 Nos 5,400 4,05,000 i Lights used / proposed Supply, installation, testing and commissioning of Dali Dimmable Ballast LED 30 Nos 5,640 1,69,200 ii Strip Driver for proposed Office Area Page 8 of 19 219shetgiri and associates S. No. DESCRIPTION UNIT QTY RATE AMOUNT Supply, installation, testing and commissioning of Control Cable for Ballast Controlling using 2CX1.5 Sqmm control cable (From Ballast to Control Panel) with 25mm rigid PVC conduit & flexible conduits with necessary fixing 200 Mtr. 131 26,160 accessories & supports etc. complete as per the technical specification & iii drawing details.
Supply, installation, testing and commissioning of Cat-6 with 25mm rigid PVC conduit & flexible conduits with necessary fixing accessories & supports etc. 100 Mtr. 94 9,360 complete as per the technical specification & drawing details.
iv Standalone PIR/Occupancy Area Sensor For Meeting Room, Utility Areas 5 Nos 5,400 27,000 v Supply, installation, testing and commissioning of DALI (Digital Addressable Lighting Interface) module for Dimming CFL, LED with DALI Ballast. The quoted rate shall be inclusive of required and suitable rating of power supply unit with internal cables etc.,DALI ballast controller suitable for controlling up 3 Lot 90,000 2,70,000 to 120 DALI ballasts in one module (60 DALI Ballast in One Loop) (1 Lot is considered for the entire single premises out of the total of three number of premises under reference) vi C Safety Supplying & shock treatment / restoration charts written in Hindi, English (Local Language) duly framed and covered with 2.8mm glass as required as 3 Nos 1002 3006 per the locations as approved by Client / Architect / Consultant at site.
i Supply and erection Standard First Aid Box complete as per specifications as per location as approved by the Client / Architect / Consultant with necessary antiseptic cream, medicine for use on wounds due burn, crepe bandage, guage bandage, medicated ready to use bandage (Band aid) adhesive tape for 3 Nos 2040 6120 medicinal use, scissors, antiseptic solution (Savlon or similar) etc. (All above contents shall be of standard makes & shall be checked, confirmed & approved the Client / Consultant for Expiry Dates of all the Products provided in First Aid Box at the time of installtion at site.) ii iii Fire Extinguishers Carbon Di-oxide (CO2) type Fire Extinguisher of 4.5 Kg capacity CO2 gas filled in brand new seamless cylinder with powder coated finish, made out of 10 No. 7500 75000 Manganese Steel, with wheel type valve, discharge Nozzel, bend and horn, a floor mounting etc. complete as per IS : 15683 with ISI mark.
ABCtypefireextinguisher4kgcapacity,filliedinbrandnewcylinderwith powdercoatedfinish,madeoutofManganeseSteel,withwheeltypevalve, b 10 No. 5500 55000 discharge Nozzel, bend and horn, floor mounting etc. complete as per IS :
15683 with ISI mark.
GRAND TOTAL 1,24,60,476.00
Note:-TheratestakenintheestimateareexcludingGST,whichshallbe at actuals.
M/s SHETGIRI & ASSOCIATES Page 9 of 19 220ESTIMATE FOR L.V WORKS FOR PROPOSED OFFICE OF PFRDA, 16TH FLOOR, MAKER TOWERS - F, CUFFE PARADE, MUMBAI Estimates for L.V System Works - Fire Alarm System, PA System, Access Control System & C.C.TV System SI Item Description Unit QTY Make Model Supply Services Unit Rate Amount Unit Rate Amount Fire Alarm System Supply of EN / Vds approved Fully redundant Fire alarm control panel EN54/VDS Compliant of 1 loop catering to 250 Detectors or Devices in any combination.
Cabinet with integrated integrated control panel, TFT/ LCD colour display and control panel with menu-driven user interface (display) with multifunctional rotation wheel or buttons incl. unit rack with main control unit with fully redundant microprocessor and SMD technology; also incl. power supply unit, charging units and DC voltage converter.
The following functions are included in the basic equipment: - PC-supported programming via integrated computer interface, changing the programming does not require any hardware intervention - Capability of saving the system configuration using flexible flash memory technology 1 - - I Wnd ae tcp he dn od ge ln ot g t iw c o fo-c r o am utp ou mte ar t is cy ss yte stm em monitoring Nos. 1 Secur nit oo tn if / ir F eIKE / SCP 520 1 ,50,000 1 ,50,000 1 5,000.00 1 5,000 - Software-controlled free assignment and linking of detectors to actuation criteria - Detector links are possible beyond various addressable loops and sub-control units - One-man maintenance for all detection zones - Programmable controls through free assignment of inputs and outputs - Individual detector disablement - Evaluation of detector states (contamination) - Real-time clock - Automatic summer-time changeover - Automatic cyclical check routine with fully automatic and detailed fault message Supply of EN / Vds approved Analogue Addressable Multisensor detector 2 h f so ha r ov f ui an ls dg t o blop ec e san ot fid to wi ng ai ot ra f e l a pp la rr r oo m gto r, c awo mil t, m ha al ia n br b lm eu t if l ol ta bfg a e uf o ultr s eif sa dos alt a sa t Sola mrr im on k er ee v /p e Hro y er t adi tn e /g t e M, ca utl oa ltrr i,m s d e e na td se od c rr t e o (Es rs N Nos. 95 Securiton / FIKE M +C UD SB 5 7 53 0 2X 5 ,100 4 ,84,500 2 15.21 2 0,445 / VDS Approved) 3 S au rp ep lal yy oo uf E tpN u t/ w V id ths a ap pp rr oo gv re ad m A mn aa blo leg u fae i lA -sd ad fr ee ps osa sib tl ie o nC .ontrol module containing Nos. 20 Securiton / FIKE BX-O1 4 ,500 9 0,000 2 15.21 4 ,304 Supply of EN / Vds approved Analogue Addressable Monitor module two 4 inputs for monitored querying of potential-free contacts and an optocoupler Nos. 10 Securiton BX-I2 3 ,874 3 8,738 2 15.21 2 ,152 input for monitoring external voltages.
Supply, installation, testing & commissioning of Addressable Manual Call Points (Break Glass Type). The same shall be square in shape & made of ABS 5 plastic material. Surface / Flush Mounting. It shall have a "Break glass" message Nos. 12 Securiton / FIKEMCP 545 - 1X - N 5 ,500 6 6,000 2 15.21 2 ,583 embedded on the glass. The addressable module shall be enclosed along with the break glass in a junction box & with required accessories.
Supply, installation, testing & commissioning of Addressable Strobe cum 6 S ho avu en d the er D (L bo lo evp e p l o ow f mer ie nd im). uT mhe 8 s 5o du Bn sd ae nr dsh aa mll ub le t im toa nd ee fo af c A ilB itS y ,p wla as lt li mc m oua nte teri da wl & it h Nos. 8 LOCAL LOCAL 3 ,382 2 7,055 2 15.21 1 ,722 mounting base & required accessories. (for office area) 7 S fau lp sep l cy e, ii ln ins gta Dll ea tt eio cn to, rte s s wti in tg h & re c qo um irm edi s as ci eo sn si on rg i eo sf .Response indicator for Above Nos. 24 Securiton / FIKE AD 301 4 ,200 1 ,00,800 2 15.21 5 ,165 8 S bu ap ckp uly p, . installation, testing & commissioning of 24V DC power pack with battery Nos. 3 Local 5 ,000 1 5,000 1 84.47 5 53 Supply and laying of 2C x 1.5 Sq.mm Copper Armoured Multi stranded FRLS 9 cable on wall / slab or structure with necessary spacer & saddles. scope shall Mtrs 1450 Finolex 9 0 1 ,30,500 4 0.00 5 8,000 also include required end termination using gland,lugs & required accessories.
Loop fire panel of proposed office to fire panel of common area (Red in Colour) 10 Commissioning charges Lot. 1 - - 7 5,000.00 7 5,000 11 Manual 5kg ABS Fire Extinguisher Nos. 15 Minimax 3 ,500 5 2,500 - - 12 Fire Bucket Nos. 3 2 ,500 7 ,500 - 1 1,62,594 1 ,84,925 TOTAL FOR FIRE ALARM SYSTEM TOTAL Rs. 1 3,47,518 PA System 1 Supply installation Testing & commissioning of 6 Watt Speakers Nos. 150.00 BOSCH 1 ,900 2,85,000 1 00.00 15,000.00 Supply installation Testing & commissioning of Booster Amplifier-550Watt (1 No 2 ofsystemconsideredforallthethreepremisesunderreferenceandloopingto Nos. 1.00 BOSCH 4 0,100 40,100 1 ,500.00 1,500.00 be done accordingly) SupplyinstallationTesting&commissioningof6ZoneCallstation(1Noof 3 systemconsideredforallthethreepremisesunderreferenceandloopingtobe Nos. 1.00 BOSCH 40,000 2 ,500.00 2,500.00 done accordingly) 4 0,000 SupplyinstallationTesting&commissioningofVoiceAlarmcontroller(1Noof 4 systemconsideredforallthethreepremisesunderreferenceandloopingtobe Nos. 1.00 BOSCH 3,00,000 4,000.00 4,000.00 done accordingly) 3,00,000 SupplyinstallationTesting&commissioningofGooseneckMicrophone(1Noof 5 systemconsideredforallthethreepremisesunderreferenceandloopingtobe Nos. 1.00 BOSCH 4 ,304 4,304 3 68.94 368.94 done accordingly) 6 Supply installation of 19" Rack to mount the above items. Nos. 1.00 BOSCH 3 ,074 3,074 3 68.94 368.94 7 S cou np dp uly it, (T pe os it nin t g w& iril na gy )ingof2CX1.5Sqmmarmouredcoppercable.WithPVC Nos. 150.00 Finolex 2 ,000 3,00,000 1 84.47 27,670.32 9 ,72,479 5 1,408.20 TOTAL FOR PA SYSTEM TOTAL Rs. 1 0,23,886.95 Access Control System
BMSWorkstationmachine:INTELCOREI5orlatestprocessorwithminimum8 GBDDRRAM,minimum1024GBSATAHardDisk, DVDR/W,LanCard 10/100/1000base-T,MultiMonitorSupport,OpticalMouse,104KeysKeyboard, 1 latestwindowsOScompatiblewithBMSSOftware,21"colour,FlatScreenType Nos. 3 Dell/HP 1 ,00,000 3,00,000 3 ,500.00 1 0,500.00 Professional, MS Office with Antivirus software.
2 Q (Mu aa kd eX s S2 pC ecT tw rao ). D (Uo Por S,A Sc ec re vs es r C Ro on otr mo ,l l Ee nr tw rai nth ceb &ui Elt xin it)12V-5ASMPSpowersupply Nos. 5 Spectra / matrix 2 5,000 1,25,000 2 ,000.00 1 0,000.00 3 12 Vdc and 6 amp power supply for Controller and electromagnetic lock Nos. 10 Local 7 99 7,994 2 45.96 2,459.58 4 B finio gs et ra pm rip n2 tR temFi pn lg ae ter sprint Reader / HIDiClass Smart card reader / 1900 Nos. 3 Spectra / matrix 7 ,000 2 1,000 1 84.47 553.41 2215 E lel ae fc dtr oo om rsa g con met pic leL to ec ak ss pw erit sh pd eo cio fr icm ata iog nn se t iccontact(600lbs)ULlistedforsingle Nos. 10 Algatec 3 ,500 3 5,000 2 45.96 2,459.58 6 S coIT mC pleP tU eS AH ccT eO ssoE rX ieI sT . Buttondeviceforaluminium,hollowmetalDoorwith Nos. 10 Local 1 ,000 1 0,000 1 84.47 1,844.69 7 SITC of Manual Break Glass Unit Nos. 4 Local 2 ,500 1 0,000 1 22.98 491.92 #2080 HID iClass Smart Card – Clamshell type (without any printing) As Per 8 Requiremen 40 HID 2 00 8,000 2 4.60 983.83 t 9 SITC Manual Panic Bar for Emergency Exit Door Nos. 4 Local 5 ,534 2 2,136 - NetXsControlEnt Enterprise Access Management Software (Make Spectra) 10 ( · L Di ace tan bs ae s f eo sr u4 p0 p0 o E rtm edp l Moy Se -Se Qs) L / Oracle Nos. 3 Spectra / matrix 1 5,372 4 6,117 6 14.90 1,844.69 · Multi user facility SupplyandLayingof6Pair/Corex0.75Sqmm,multistrand,copper, 11 sheilded,Screened cable between the access controller and Card reader Mtrs. 750 Finolex 1 50 1,12,500 1 5.00 1 1,250.00 INCLUDING GI CONDUIT SupplyandLayingof4Pair/Corex0.75Sqmm,multistrand,copper,sheilded cablebetweentheaccesscontrollerandEMLock/doorsensor/PushButton/ 12 FA panels(release lock in case of fire) INCLUDING GI CONDUIT Mtrs. 750 Finolex 3 50 2,62,500 3 5.00 2 6,250.00 13 25 mm GI Conduit Mtrs. 30 1 66 4,981 2 4.60 737.88 14 Cat6a Cable for Controllers to Network Rack INCLUDING GI CONDUIT Mtrs. 400 systemx 2 50 1,00,000 9 .22 3,689.38 15 Erection and Commissioning Charges Lot. 1 - 1 5,000.00 1 5,000.00 1 0,65,228 8 8,064.95 TOTAL FOR ACCESS CONTROL SYSTEM TOTAL Rs. 1 1,53,292.71 C.C.TV. System Full HD at 30fps for clear, detailed images • CMOS sensor delivers high performance in low light • Wide angle F/1.6 Canon lens offers 1 a • M95 u° l tA i-n sg trle e ao mf V inie gw of MJPEG and H.264 Nos. 60 matr Hix ik / v c isa in on non / 2 ,275 1 ,36,507 1 22.98 7,378.75 video in Full HD or lower resolutions • Direct recording/playback from MicroSD card (64GB) 2 16ch DVR with 8 tb hdd + NVR rack - motion bases recoding for 90 days- Nos. 4 4 3,043 1 ,72,171 6 ,148.96 2 4,595.84 3 32" LED display Nos. 3 3 4,434 1 ,03,303 1 ,229.79 3,689.38 CCTV/RGcabletocannectcamerafromNVR0rswitchincludingGIconduit 4 (point Wiring) + required power point including wiring and conduits Nos. 125 Finolex, Polycab 1 ,783 2 ,22,900 1 84.47 2 3,058.60 5 16 channel POE switch Nos. 4 1 1,683 4 6,732 - - 6 GI Conduit 25mm dia Mtrs. 0 - - - 6 ,81,612 5 8,722.57 TOTAL FOR CCTV SYSTEM TOTAL Rs. 7 ,40,334.78
Note:-TheratestakenintheestimateareexcludingGST,whichshallbeat actuals.
FOR M/s SHETGIRI & ASSOCIATES 222ESTIMATE FOR FIRE FIGHTING WORKS FOR PROPOSED OFFICE OF PFRDA, 16TH FLOOR, MAKER TOWERS - F, CUFFE PARADE, MUMBAI THE SAID ESTIMATE HAS NOT BEEN CONSIDERED IN THE SUMMARY OF COSTS & IMPELEMENTATION THEREIN. THE REASON FOR THE SAME IS THAT FIRE FIGHTING SYSTEMS ESPECIALLY FIRE SPRINKLERS WITHIN THE PREMISES DOES NOT EXIST AND AS SUCH APPROVAL / CONSENT FROM THE SOCIETY WOULD BE REQUIRED FOR IMPLEMENTATION OF THE SAID WORKS Rate Amount Item Description Qty Unit Rs Rs
1.0 SPRINKLER SYSTEM The scope of this section covers the design, supply, installation,testing&commissioningofthefollowing as per technical specifications and drawings complete with all interconnections with access control&mainfirealarampanelfromthefirealarm panel of the proposed office.
Heavy, ‘C’ class G.I. pipes IS 1239 with screwed or welded joints, including all fittings, MS supports, cutting the pipes to correct length jointing with G.I threadedfitting,fixingwithclampstoM.S.brackets/ 1 .10 hangers including testing to 15 kgs/cm2 pressure, painting,insertedrubbergasketswith2coatsofZinc Dichromateprimerandtwocoatofapprovedenamel paint. (PO red) AllGIfittings50mmdia&belowshallbehotdipped Forged Socket Weld/Socket Screwed, and 65 mm & above shall be Butt Weld b 100 mm dia 50.00 Rm 3 ,070.00 1,53,500.00 c 80 mm dia 97.00 Rm 2 ,460.00 2,38,620.00 d 65 mm dia 63.00 Rm 2 ,263.20 1,42,581.60 e 50 mm dia 253.00 Rm 1 ,935.20 4,89,605.60 f 40 mm dia 81.00 Rm 1 ,672.80 1,35,496.80 g 32 mm dia 198.00 Rm 1 ,476.00 2,92,248.00 h 25 mm dia 513.00 Rm 1 ,344.80 6,89,882.40 Cast iron butterflyvalvewithpressurerating PN16 kg/sqcm standard pattern (Horizontal / Vertical )
1.2.0 withnecessaryflangedjointsbyprovidingnecessary pairofM.S.flangeasperE-table,nuts,bolts,gaskets, etc. b 100 mm dia 0.00 Nos - c 80 mm dia 1.00 Nos 5 ,500.00 5,500.00 d 65 mm dia UR Nos e 50 mm dia 0.00 Nos Supervisory/tamperforexistingandnewbutteryfly
1.3.0
valves: b 100 mm dia Nos - c 80 mm dia 1.00 Nos 2 ,500.00 2,500.00 d 65 mm dia UR Nos e 50 mm dia 0.00 Nos
2231.5.0 Pendent / Upright / Sidewall type sprinkler Concealed Pendent type sprinkler of 15 NB, a Quartzoid bulb type 68 deg.with adjustable SS 230.00 Nos 700.00 1,61,000.00 escutcheon plate Pendenttypesprinklerof15NB,Quartzoidbulbtype b Nos 750.00 - 79 deg.with adjustable SS escutcheon plate Uprighttypesprinklerof15NB,Quartzoidbulbtype c Nos - 68 deg.
SideWallsprinklerof15NB,Quartzoidbulbtype68 d Nos - deg.with adjustable escutcheon plate SideWallsprinklerof15NB,Quartzoidbulbtype79 e Nos - deg.with adjustable escutcheon plate SprinklerFlexibledroppipesmadeofCorruggatedSS Tubing to with stand 16 Bar pressure with welded
1.6.0 reducerononeendtodirectlyaccomadatesprinkler &femalechecknutontheotherendtoconnecttothe branch pipe with supports complete a 1000 mm long 100.00 Nos 2 ,300.00 2,30,000.00 b 1500 mm long 130.00 Nos 2 ,600.00 3,38,000.00
1.7.0 Flow switch with 2 sets of SPDT switch 1.00 Nos 4 ,500.00 4,500.00
1.8.0 Pressure guage 100mm dial 0-10KG /sq cm 1.00 Nos 2 ,500.00 2,500.00 50 mm dia Drain & test Valve assembly with sight
1.9.0 1.00 Nos 18,500.00 18,500.00 glass arrangement complete with union 25 mm dia Drain & test Valve assembly with sight
1.10.0 1.00 Nos 12,500.00 12,500.00 glass arrangement complete with union Automatic Air releasevalveincluding 20/25mm dia
1.11.0 5.00 Nos 2 ,000.00 10,000.00 ball valves for isolation and drain
1.12.0 SS Ball Valve a 25 NB 1.00 Nos 4 ,500.00 4,500.00 b 50 NB 1.00 Nos 7 ,500.00 7,500.00 CINonReturnValvedualplatetypecompletewithGI
1.13.0 flanges, nut bolts, gaskets etc b 100 mm dia Nos - c 80 mm dia 1.00 Nos 6 ,500.00 6,500.00 d 65 mm dia UR Nos
2241.14.0 Structural Supports 500.00 KGS 140.00 70,000.00 Fabricationofstands/supportsetcwithM.S.50x50 x6 angles,100x50x6mmCchannelsalongwithall the hardware required for fixing, grouting, one coat of red oxide and two coats of synthetic paint. Shop drawings of structural supports to be prepared by vendor for approval.
10KGNOVAC120Thermalexpansiontank(Server/ 1 .15 4.00 No. 4,50,000.00 18,00,000.00 electrical room) Supplying and/or installing and/or testing and /or commissioningand /or providingpersonnelonsite asapplicable. Thetenderertoquotetotalcostforthe under mentioned items but attach separate sheets withcompletedetailsofmaterial,scopeofwork,cost 1 .16 1.00 JOB 35,000.00 35,000.00 etc. as applicable. Lumpsum costs shall not be accepted The scope of this section covers the design, supply, installation,testing&commissioningofthefollowing as per technical specifications and data sheets & compliance statement.
Shop Drawings a b As-Built Drawings & Operating Manuals c Training of Employer's Representatives d Site Management and Temporary Protection Co-ordination with other Contractors & Project e Manager Costs towards preparing of Asbuilt drawings and f submission of approved tracing with 6 prints of each Onsite service for the DLP / min. of 12 months g specified period after handover Labelling using Brother make TZ tapes in the specified format, color and size. All detectors, h devices,controlpanels,etcshallbelabelledasperthe clients and consultants requirements.
Gettingapprovalfromthelocalfireauthority &land i lord as per the requirement to get OC for the 1.00 JOB - premices.
TOTAL FOR FIRE FIGHTING WORK Rs. 48,50,434.40
Note:- The rates taken in the estimate are excluding GST, which shall be at actuals.
FOR SHETGIRI AND ASSOCIATES 225ESTIMATE FOR AIR CONDITIONING (HVAC) WORKS FOR PROPOSED OFFICE OF PFRDA, 16TH FLOOR, MAKER TOWERS - F, CUFFE PARADE, MUMBAI ESTIMATE FOR VRF HVAC SYSTEM - HIGH SIDE & LOW SIDE SYSTEM Sr. No. DESCRIPTION QTY UNIT RATE AMOUNT
A HIGH SIDE WORKS: - Supply of Variable Refrigerant Flow ( VRF ) AC
1.0 System of MAKE: LG / MITSUBISHI ELECTRIC /VOLTAS / Supply, of inverter /Digital scroll compressor with Variable refrigerant system (VRF) connectable to multiple indoor units. Outdoor unit is factory assembled weather proof casing constructed from heavygaugemildsteelpanels. Theunitiscompletely factorywiredandtestedwithnecessarycontrolsand charged with refrigerant. The compressor is highly efficientScroll/Rotarytype.Thealuminumfinsshall be covered with anti-corrosion resin. Unit is equipped with oil recovery system to ensure stable operation with long refrigerant piping. Units are testedandcommissionedwithadditionalrefrigerant.
The unit shall be compatible for BMS operation
(optional)Necessaryrelaycard/softintegratortobe
provided, Including rubber pads for outdoor units etc. BEE 5 star Rated. Rate shall include Refrigerant gas etc complete 1 Supply of OUTDOOR UNITS - VRF System a 34HP 0 Nos. 7,50,000.00 - b 24HP 0 Nos. 5,00,000.00 - c 22HP 5 Nos. 4,00,000.00 2 0,00,000.00 2 Supply of Cassette units a 4.0 TR four way 0 Nos. 4 8,000.00 - b 3.0 TR four way 24 Nos. 4 2,500.00 1 0,20,000.00 c 2.5 TR one way 0 Nos. 5 5,000.00 - d 2.0 TR four way 4 Nos. 4 0,000.00 1 ,60,000.00 e 2.0 TR one way 0 Nos. 4 5,000.00 - f 1.5 TR one way 0 Nos. 4 0,000.00 - g 1.5 TR compact 2x2 4 Nos. 3 0,000.00 1 ,20,000.00 h 1.0 TR compact 2x2 0 Nos. 2 5,000.00 - i HIGH Wall 2.5TR 0 Nos. 3 0,000.00 - j HIGH Wall 2.0TR 0 Nos. 2 7,000.00 - k HIGH Wall 1.5TR 4 Nos. 2 5,000.00 1 ,00,000.00 l HIGH Wall 1.0TR 0 Nos. 1 7,000.00 - m HIGH Wall 0.8TR 0 Nos. 1 4,000.00 - Supply of "Y" joint Refnets as required for VRF 3 36 Nos. 4 ,500.00 1 ,62,000.00 System 226SUPPLYOF1.0TRDX-typeHIGHWALLUNITSwith Scroll/Rotarycompressorswithinverterbasedtype 4 R32, Refrigerant. BEE 5 star. Rate shall include 1 Nos. 3 5,000.00 3 5,000.00 Refrigerant pipe, drain pipe, electrical cabling etc complete.
Supplyofprogrammablecentralcontrol unitremote 5 control with soft integration communication with 1 Lot 1,50,000.00 1 ,50,000.00 BMS for VRF UNITS.
Supply of Heavy duty fan filter unit for fresh air 6 2 Nos. 1 5,000.00 3 0,000.00 2200CFM 25 mm ESP 7 Supply of air valve to fit in cassette unit for fresh air a 150 CFM 0 Nos. 5 ,000.00 - b 100 CFM 0 Nos. 5 ,000.00 - c 50 CFM 44 Nos. 3 ,000.00 1 ,32,000.00 TOTAL OF HIGH SIDE WORKS 39,09,000.00 227B LOW SIDE WORKS: - Installation, Testing, and Commissioning of Variable
1.0 Refrigerant Flow ( VRF ) AC System BEE 5 star OUTDOOR UNITS - VRF System a 34 HP 0 Nos. 45,000.00 - b 24 HP 0 Nos. 35,000.00 - c 22 HP 5 Nos. 35,000.00 1 ,75,000.00 Installation, Testing, and Commissioning of Cassette
2.0 units a 4.0 TR four way 0 Nos. 2 ,500.00 - b 3.0 TR four way 24 Nos. 2 ,500.00 6 0,000.00 c 2.5 TR one way 0 Nos. 2 ,500.00 - d 2.0 TR four way 4 Nos. 2 ,500.00 1 0,000.00 e 2.0 TR one way 0 Nos. 2 ,500.00 - f 1.5 TR one way 0 Nos. 2 ,500.00 - g 1.5 TR compact 2x2 4 Nos. 2 ,500.00 1 0,000.00 h 1.0 TR compact 2x2 0 Nos. 2 ,500.00 - i HIGH Wall 2.5TR 0 Nos. 2 ,500.00 - j HIGH Wall 2.0TR 0 Nos. 2 ,500.00 - k HIGH Wall 1.5TR 4 Nos. 2 ,500.00 1 0,000.00 l HIGH Wall 1.0TR 0 Nos. 2 ,500.00 - m HIGH Wall 0.8TR 0 Nos. 2 ,500.00 - Installation,Testing,andCommissioningof1.0TRDX - type HIGH WALL UNITS with Scroll / Rotary compressors with inverter based type R32, R410,
3.0 1 Nos. 3 ,500.00 3,500.00 R22 Refrigerant. BEE 5star. Rate shall include Refrigerant pipe, drain pipe, electrical cabling etc complete.
4.0 Refrigerant Piping Supply installation testing & commissioning of Refrigerant piping for Suction Line & Liquid Line a with19mm&13mmnitrilerubberinsulation(both 1250 Mtr 7 50.00 9 ,37,500.00 line to geth are considered as one length) complete with GI support from ceiling, wall,floor Supply installation testing & commissioning of b Refrigerant piping for Suction Line & Liquid Line 72 Mtr 7 50.00 5 4,000.00 09mm & 09mm For DX Units.
5.0 Communication Cable Supply installation testing & commissioning of a Control Cabling - From All Indoor Units - to the 1500 Mtr 1 10.00 1 ,65,000.00 Outdoor Units. (1.5 sqmm 2core shielded cable.) Supply installation testing & commissioning of b CommunicationCablingforHighwallUnit-FromAll 86 Mtr 1 10.00 9,460.00 Indoor Units to the Outdoor Units - 4 core cable 228Supply installation testing & commissioning of PVC drain pipe complete with allfittingsand accessories
6.0 with 6mm nitrile rubber sleeve for VRF based Cassette Units a 20mm 950 Mtr 9 0.00 8 5,500.00 b 25mm 600 Mtr 1 05.00 6 3,000.00 c 32mm 400 Mtr 1 15.00 4 6,000.00 Installation testing & commissioning of "Y" joint
7.0 36 Nos. 5 00.00 1 8,000.00 Refnets as required for VRF system (Refrigerant)
8.0 MS FRAME WORK a M. S. Framework for installing Outdoor Units 6 Nos. 2 0,000.00 1 ,20,000.00 inclusive of vibration isolators b M. S. Framework L /Table Type with railing for installingOutdoorUnitswithvibrationisolationpads 1 Nos. 2 ,500.00 2,500.00 required for 1.0 TR Hi-Wall Split Units
9.0 Additional Refrigerant Gas R-410 350 Kg 8 50.00 2 ,97,500.00
10.0 Supply,Installation,Testing&CommissioningofDual AC ON / OFF TIMER including all accessories etc. 1 Nos. 3 ,500.00 3,500.00 complete.
11.0 Supply, Installation, Testing & Commissioning of programmable central control unit remote control 3 Nos. 3 0,000.00 9 0,000.00 with soft integration communication with BMS for VRF UNITS.
12.0 Preparationof"shopdrawings" and"ASBUILT"and getting it approved from architect consultant and 1 Job 3 5,000.00 3 5,000.00 client.
Installation testing commissioning of Heavy duty
13.0 1 Nos. 4 ,500.00 4,500.00 axial fan for fresh air 5000CFM 25 mm ESP Installationtestingandcommissioningofairvalveto
14.0 fit in cassette unit a 150 CFM 1 Nos. 1 00.00 1 00.00 b 100 CFM 1 Nos. 1 00.00 1 00.00 c 50 CFM 60 Nos. 1 00.00 6,000.00 SITC of 6" pvc pipe for fresh air suspended from
15.0 300 Mtr 5 00.00 1 ,50,000.00 ceiling including all fittings & accessories
Waranty: 1year DLP +2 years (To be taken up by
16.0 PFRDAseparatelysinceDLPof12monthsisalready 0 Lot 1 2,00,000.00 QRO covered and Maching warranty covered by the OEM)
22917.0 GSS Ducting Supply, installation & testing of entire duct work as per SMACNA standards.
Rolamate or equiv (4 Bolt - Slip onFlanges with in- builtsealant&Pittsburghseamlock).Ductingcostto include all elbows, turning vanes, VCDs, GI fully threadedrods/Gripplesupportsystem,GI supports, vibration isolators, sealants, neoprene gaskets, etc.
Also, cost for pressure testing of main ducts.
Duct pressure - SMACNA 2 INCH (500 PASCAL) Upto 450 mm 26 G - C & S/SS Cleats 20 smt 2 ,000.00 4 0,000.00 451 - 750 -- 26 G - F 50 smt 2 ,100.00 1 ,05,000.00 751 - 1000 -- 24 G - F 30 smt 2 ,300.00 6 9,000.00 1001 - 1200 -- 22 G - F 30 smt 2 ,500.00 7 5,000.00
SUB TOTAL OF LOW SIDE WORKS: Rs. 26,45,160 SUMMARY OF COSTS TOTAL OF HIGH SIDE WORKS Rs. 3 9,09,000.00
SUB TOTAL OF LOW SIDE WORKS: Rs. 26,45,160 65,54,160 TOTAL OF AIR CONDITIONING WORKS Rs.
Note:- The rates taken in the estimate are excluding GST, which shall be at actuals.
FOR SHETGIRI AND ASSOCIATES 230PROPOSED INTERIOR RENOVATION & FURNISHING WORKS FOR OFFICE OF PFRDA, 16TH FLOOR, MAKER TOWERS - F, CUFFE PARADE, MUMBAI SUMMARY STATEMENT OF AV WORKS S.NO DESCRIPTION OF WORKS AMOUNT IN INR 1 TOTAL COST OF THE BOARDROOM Rs. 69,41,730.00 2 TOTAL COST OF THE EXECUTIVE BOARDROOM Rs. 7,40,510.00 3 TOTAL COST OF THE OTHER AREAS Rs. 6,70,000.00 GRAND TOTAL COST OF THE AV WORKS Rs. 83,52,240.00
Note : The Rates and Amount quoted hereinabove shall be Exclusive of GST. GST as applicable based on the prevailing rate, rules, regulations & guidelines shall be additional at actuals.
For SHETGIRI AND ASSOCIATES 231BILL OF QUANTITIES- ORANGE BUSINESS SOLUTIONS
PROJECT: PFRDA Date: 03-02-2026 Rev-02 Arechtect & Consultants : Shetgiri & Associates PEPL
Room Details : 23 PAX boardroom
Quote Submitted by : PMI Enterprises Pvt Ltd.
Designed By : Paresh Birari, Site visited by : CAD Layout S.No. Product Description Unit Qty. Make & Model Unit Price Total Price A Audio Solution FoH Conference SITCof6.5"Wallmountspeakers,2-waywallmountspeakertobesuppliewithwallmountkit,@100 A.1 Nos. 2 JBL or Equivalent ₹ 25,500.00 ₹ 51,000.00 Room speakers watts @ 8ohms / 70v/100v SITCof4"inceilingspeakers,2-waysin-ceiling,@30watts@8ohms/70/100v,whitecolorwithmetal Ceiling speakers Nos. 6 JBL or Equivalent ₹ 12,450.00 ₹ 74,700.00 back can Powersoft or A.2 Amplifier SITC of 4-channel amplifier 80 watts @ 8ohms / 70v / 100v amplifier with DANTE interface Nos. 1 ₹ 1 ,05,000.00 ₹ 1,05,000.00 Equivalent Powersoft or A.4 Amplifier SITC of 4-channel amplifier 150 watts @ 8ohms / 70v / 100v amplifier with DANTE interface Nos. 1 ₹ 1 ,25,000.00 ₹ 1,25,000.00 Equivalent Erthport or A.6 DSP processor SITC of 8x8 DSP processor with DNATE interface with 3rd party control over IP/RS-232 Nos. 1 ₹ 1 ,95,000.00 ₹ 1,95,000.00 equivalent SITCofchairmanunitwith450mmgooseneckmicrophoneORBoundarymicrophonewithONMute& Peoplelink or A.7 Chiraman unit Nos. 1 ₹ 49,000.00 ₹ 49,000.00 overrriding buttons with Flush-mount chairman unit Equivalent SITCofDelegateunitwith450mmgooseneckmicrophoneORBoundarymicrophonewithON/Mute Peoplelink or A.8 Delegate Unit Nos. 22 ₹ 47,000.00 ₹ 10,34,000.00 with Flush-mount Delegate unit Equivalent Conf. Control Peoplelink or A.9 SITC of Conference control unit compatible with above chairman / Delegate system Nos. 1 ₹ 1 ,35,000.00 ₹ 1,35,000.00 unit Equivalent B VIDEO Solution SITCof136"LEDwallwithnativeFullHDresolution,achievedusing1.56pporLower,min.brightness Peoplelink or B.1 Front LED wall of600nits,COBFlip-chiptechnology,tobesuppliedwith4kcompatiblecontrollerwith2HDMIinputs Nos. 1 ₹ 2 1,95,000.00 ₹ 21,95,000.00 Equivalent & wall mounting fabrication OR SITC of 110"LEDmonitor,NativeUHD(3840x2160)resolution, Min.500 nits brightness,Pro series Ftont wall LED display, min. 1000:1 contrast ratio, min. 3 x HDMI inputs, 2xUSB interfaces, to supplied with wall Nos. RO LG or Equivalent ₹ 1 6,55,000.00 ₹ - TV mount kit SITC of 65"LED TV,Native UHDresolution, with min. 400 nits brightness to besupplied with wall B.2 Side wall LED TV Nos. 1 LG or Equivalent ₹ 67,500.00 ₹ 67,500.00 mount kit [one on Left side & other at Rightside] SITCofRackPCfornativepresentation&cloudconferencing,i-7generation12,8GBRAM,withbuilt- B.3 Rack PC Nos. RO Dell or Equivalent ₹ 37,550.00 ₹ - in 256GB SSD, min. 4 x USB ports, 1 x HDMI output to be supplied with wireless keyboard & mouse Logitech or B.4 Accessories SITC of wireless Keyboard & mounse to work with above rack PC Nos. RO ₹ 6,500.00 ₹ - Equivalent SITCofUCcamera,20xopticalzoom,PRZcamerawithUSBoutput,auto-framing,&3rdpartycontrol Peoplelink or B.5 Camera Nos. 1 ₹ 1 ,35,000.00 ₹ 1,35,000.00 ports Equivalent Chairnman SITC of motorised operated table embeded display, 17" non-interactive display, auto-tild upto Peoplelink or B.6 Nos. RO ₹ 2 ,35,000.00 ₹ - display 20degrees with HDMI interface, complete motorised assembly with 3rd party control Equivalent 232C Conferencing Solution SITCofNativeWEBEXsolutionwithmin.1xUSB-C,2XHDMIinterfacesforcamera&content,min.2x HDMIoutputsforVideooutput,min.2XLANports,min.min2xAudioLineinputs,min.2xAudioLine C.1 Teams solution Nos. 1 CISCO WEBEX ₹ 1 0,95,650.00 ₹ 10,95,650.00 outputtobesuppliedwithmin.10"wiredtouchpanel,tobesuppliedwithRS-232toUSBadapter,to be suplied with 3 years WEBEX licenses, 4k60, (4:4:4) Kramer or C.2 Accessories SITC of HDMI to USB adapter should support to mulit-window output Nos. RO ₹ 49,500.00 ₹ - Equivalent D Automation System SITCofautomationprocessorwithmin.3xSerialcontrolports,4xIRorone-wayserialport,4xRelay Automation Crestron or D.1 ports, DUAL LAN/ Ethernet control/expansion port, 1x Propritary expansion port, should have required Nos. 1 ₹ 2 ,35,000.00 ₹ 2,35,000.00 processor Equivalent in-built memory D.2 Touch panel Above processor should work with Touch panel supplied along with Video conference unit Nos. 1 ₹ - ₹ - Wirelss user SITCof10"iPADtobeusedaswirelessuserinterface,min.32GBwithNOSIM,tobesuppliedwith D.3 Nos. 1 Apple ₹ 49,000.00 ₹ 49,000.00 interface Apploication software required to interface with Automation processor Lighting Dynalite or D.4 SITC of DALI dimmable lighting interface to control min. 96 Lights with LED COVE strip, Nos. RO ₹ 68,000.00 ₹ - Interface Equivalent Multi-cannel SITCofMultipleloadmulti-channeldimmer,4-portsDALIdimmable,4-portsincadescentdownlights,4- Dynalite or D.5 Nos. RO ₹ 69,000.00 dimmer ports ON/Off relay based switching Equivalent SITC of 6-button panel with face plate, cover plate base plate to be supplied with Button control Dynalite or D.6 Accessories Nos. RO ₹ 31,450.00 ₹ - interface with dimmers Equivalent Dynalite or D.7 Accessories SITC of RS232 control interface between automation processor & Lighting controllers Nos. R0 ₹ 31,230.00 ₹ - Equivalent Netgear or D.8 Accessories SITC of wireless access points for wifi internal network for AV devices Nos. 2 ₹ 3,500.00 ₹ 7,000.00 Equivalent Netgear or D.10 Accessories SITC of 10 port ethernet switch, with 8-ports RJ45 POE+ ports, 2 x SFP ports for expansion Nos. 1 ₹ 19,890.00 ₹ 19,890.00 Equivalent 233E Presentation & Switching system Cable cubby SITCofcablecubbywith1xuniversalpowersocket,1xUSB-C/USB-Achargingpoint,1xHDMIcable[2 E.1 with AV Nos. 3 Custom ₹ 21,450.00 ₹ 64,350.00 cable cubbies with USB-C & HDMI connectivity & 1 cable cubby is with HDMI connectivity only] connectivity Cable cubby E.2 witout AV SITC of cable cubby with 2xuniversal power socket, 1x USB-C / USB-A charging point Nos. 4 Custom ₹ 21,450.00 ₹ 85,800.00 connectivity SITCof1xHDMI+1xUSB-Cinputswith1xHDMIoutput,2x1autoswitcher,with3rdpartycontrol Kramer or E.3 Hybrid Switcher Nos. 2 ₹ 1 ,75,000.00 ₹ 3,50,000.00 over IP/RS232 control, 4k, 4k60(4:4:4) Equivalent HDMI matrix SITCof8x8HDMImatrixswitcherwithStereooutput,8HDMIinputsto8HDMIoutputs,3rdparty Kramer or E.4 Nos. 1 ₹ 5 ,90,000.00 ₹ 5,90,000.00 Switcher control over IP/RS232, 4k, 4k60(4:4:4) Equivalent HDMi Patch SITCof35ftHDMIcablefromcablecubbytoAVrack(belowtheTabletoRackspace&rackspaceto Kramer or E.5 Nos. 5 ₹ 12,900.00 ₹ 64,500.00 cable 65" TV) Equivalent HDMi Patch Kramer or E.6 SITC of 15 ft HDMI cable from AV rack to main TV/LED wall Nos. 1 ₹ 5,990.00 ₹ 5,990.00 cable Equivalent HDMi Patch Kramer or E.7 SITC of 6 ft/2 mtr 4k ready HDMI patch cabe, 4k, male to male Nos. 6 ₹ 2,350.00 ₹ 14,100.00 cable Equivalent USB-C patch Kramer or E.7 SITC of 6ft/2ft full support UB-C cable Nos. 3 ₹ 2,550.00 ₹ 7,650.00 cable Equivalent Wireless SITC of wireless presentation system, compatible with iOS/MacOS/Android Mirroring/ Window E.8 presentation Nos. 1 Barco or Equivalent ₹ 85,000.00 ₹ 85,000.00 miracast system F CABLE & ACCESSORIES SITCof12UAVrack,800x1000mm,withFANsonTop,casterwheels,doorsonside,2shelfs&rack F.1 AV rack Nos. 2 Valrack ₹ 14,500.00 ₹ 29,000.00 hardware Audio & control Supply & Layingof Lineaudio cable,Sheilded 2 corecoppercable.[to berun through conduits or Belden or F.2 Mtrs 200 ₹ 95.00 ₹ 19,000.00 cable raceways - conduit & raceway work is not included in scope] equivalent Supply & Laying of speaker cables, 2 core, min. 16 AWG or 1.5 sqr. mm copper cable.[to berun RR Kabel or F.3 Speaker cable Mtrs 200 ₹ 85.00 ₹ 17,000.00 through conduits or raceways - conduit & raceway work is not included in scope] Equivalent F.4 CAT6 cable Supply & laying of Sheilded CAT6 cable Mtrs 300 Dlink or Equivalent ₹ 62.00 ₹ 18,600.00 F.5 Accessories SITC of Connectors, & other installation accessories like sleevs, small patchs etc LS 1 Various ₹ 18,000.00 ₹ 18,000.00 Total cost of the Project without GST ₹ 69,41,730.00 GST@18% ₹ 12,49,511.40 Total cost of project including GST ₹ 8 1,91,241.40 234BILL OF QUANTITIES- ORANGE BUSINESS SOLUTIONS
PROJECT: PFRDA Date: 03-02-2026 Rev-02 Arechtect & Consultants : Shetgiri & Associates PEPL
Room Details : Executive Meeting room
Quote Submitted by : PMI Enterprises Pvt Ltd.
Designed By : Paresh Birari, Site visited by : CAD Layout S.No. Product Description Unit Qty. Make & Model Unit Price Total Price A Audio Solution A.1 B VIDEO Solution SITC of 75" LED TV, Native UHD resolution, with min. 400 nits brightness to be supplied with wall B.1 Front TV Nos. 1 LG or Equivalent ₹ 1 ,36,000.00 ₹ 1 ,36,000.00 mount kit SITCofRackPCfornativepresentation&cloudconferencing,i-7generation12,8GBRAM,withbuilt- B.2 Rack PC Nos. RO Dell or Equivalent ₹ 3 7,550.00 ₹ - in 256GB SSD, min. 4 x USB ports, 1 x HDMI output to be supplied with wireless keyboard & mouse Logitech or B.3 Accessories SITC of wireless Keyboard & mounse to work with above rack PC Nos. RO ₹ 6 ,500.00 ₹ - Equivalent C Conferencing Solution SITCofnativeWEBEXAllinonevideobar,includesCamera,mcirophones&speakers,sufficientfor20 CISCO WEBEX or C.1 Teams solution ft depth room size, with Auto-framing, speaker tracking facility, to be supplied with min. 8" touch Nos. 1 ₹ 5 ,05,650.00 ₹ 5 ,05,650.00 Equivalent panel to dial/accept/ end the calls.
CISCO WEBEX or C.2 Accessories SITC of wired table top expansion microphone, comaprtible with above device Nos. 1 ₹ 2 9,850.00 ₹ 2 9,850.00 Equivalent D Presentation & Switching system D.1 Cable cubby SITC of cable cubby with 1xuniversal power socket, 1x USB-C / USB-A charging point, 1xHDMI cable Nos. 1 Custom ₹ 2 1,450.00 ₹ 2 1,450.00 Cable cubby E.2 witout AV SITC of cable cubby with 2xuniversal power socket, 1x USB-C / USB-A charging point Nos. 1 Custom ₹ 2 1,450.00 ₹ 2 1,450.00 connectivity HDMi Patch Kramer or D.2 SITC of 25 ft/5 mtr 4k ready HDMI patch cabe, 4k, male to male Nos. 1 ₹ 6 ,500.00 ₹ 6 ,500.00 cable Equivalent USB-C patch Kramer or D.3 SITC of 25 ft/5 mtr 4k ready USB-C patch cabe, full support cable Nos. 1 ₹ 9 ,990.00 ₹ 9 ,990.00 cable Equivalent E CABLE & ACCESSORIES E.1 CAT6 cable Supply & laying of Sheilded CAT6 cable Mtrs 10 Dlink or Equivalent ₹ 6 2.00 ₹ 6 20.00 E.2 Accessories SITC of Connectors, & other installation accessories like sleevs, small patchs etc LS 1 Various ₹ 9 ,000.00 ₹ 9 ,000.00 Total cost of the Project without GST ₹ 7,40,510.00 GST@18% ₹ 1 ,33,291.80 Total cost of project including GST ₹ 8,73,801.80 235BILL OF QUANTITIES- ORANGE BUSINESS SOLUTIONS
PROJECT: PFRDA Date: 03-02-2026 Rev-02 Arechtect & Consultants : Shetgiri & Associates PEPL
Room Details : Other areas
Quote Submitted by : PMI Enterprises Pvt Ltd.
Designed By : Paresh Birari, Site visited by : CAD Layout S.No. Product Description Unit Qty. Make & Model Unit Price Total Price A Sr. Executive Dinning area SITC of 55" LED TV, Native UHD resolution, with min. 400 nits brightness to be supplied with wall A.1 TV Nos. 1 LG or Equivalent ₹ 5 4,000.00 ₹ 5 4,000.00 mount kit B Executive Dinning area SITC of 55" LED TV, Native UHD resolution, with min. 400 nits brightness to be supplied with wall B.1 TV Nos. 1 LG or Equivalent ₹ 5 4,000.00 ₹ 5 4,000.00 mount kit C Sr. Executive Waiting Lounge /area SITC of 75" LED TV, Native UHD resolution, with min. 400 nits brightness to be supplied with wall C.1 TV Nos. 1 LG or Equivalent ₹ 1 ,36,000.00 ₹ 1 ,36,000.00 mount kit D Chariperson Cabin SITC of 86" LED TV, Native UHD resolution, with min. 400 nits brightness to be supplied with wall D.1 TV Nos. 1 LG or Equivalent ₹ 1 ,96,000.00 ₹ 1 ,96,000.00 mount kit Wireless D.2 SITC of wireless presentation system with MacOS/Android/Windows devices Nos. 1 Barco or Equivalent ₹ 8 5,000.00 ₹ 8 5,000.00 presentation E Reception SITC of 75" LED TV, Native UHD resolution, with min. 400 nits brightness to be supplied with wall E.1 TV Nos. 1 LG or Equivalent ₹ 1 ,36,000.00 ₹ 1 ,36,000.00 mount kit E.2 Accessories SITC of Connectors, & other installation accessories like sleevs, small patchs etc LS 1 Various ₹ 9 ,000.00 ₹ 9 ,000.00 Total cost of the Project without GST ₹ 6,70,000.00 GST@18% ₹ 1 ,20,600.00 Total cost of project including GST ₹ 7,90,600.00 236